TAPEŒ‡XЭK,^mW'‰Microsoft SQL ServerRAID ;XіxY—3ЬMˆ'цдЋ+=ю­№SPAD&4SFMB819SSETДdп8zmW'‰ №Поoо| G‹‚‘ЕЁKSTANDARDSSTORE\AdministratorSPAD6$VOLBtb IMUmW'‰D:DATASTANDARDSSTORESPADvdMSCI8:MQCI„ŠSCIN€|FЅ7т yš”yзyš”x›”TUqVmW'‰D4Pczw Xd VФOм‰ТGЅB;Щћцyзd-^W!N Ю3hbЇE„іЯ™#iAЙcїљž› а4d-^W!N Ю3hbЇE„@eSpecsSTANDARDSSTORESFGI>0PRIMARYSFINц„ ИВ@Ірџџџ@ЩˆрџџџВx›”іЯ™#iAЙcїљž›yš”yзyš”w@„HзaЬeSpecs_DataD:\DATABASE\data\eSpecs_Data.MDFSFINр <Єрџџџ рџџџyš”yзyš”eSpecs_LogD:\DATABASE\log\eSpecs_Log.LDFSPADMSDA<<APAD€–MQDAw~cу^y$РG 0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцџџџџ ЩˆЩ‘ €џџџџwc”Dжччй-E—ЏAеЯ,.0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцрџџџџ ЩˆЩ‘ €џџџџwc”Dжччй-E—ЏAеЯ,.0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц№џџџџ ЩˆЩ‘ €џџџџwc”Dжччй-E—ЏAеЯ,.0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцџџџџ ЩˆЩ‘ €џџџџwc”Dжччй-E—ЏAеЯ,.0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцџџџџ ЩˆЩ‘ €џџџџwc”Dжччй-E–ЏAеЯ,.0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц џџџџ ЩˆЩ‘ €џџџџwc”Dжччй-E—ЏAеЯ,.0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц0џџџџ ЩˆЩ‘ €џџџџwc”Dжччй-E—ЏAеЯ,.0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц@џџџџ ЩˆЩ‘ €џџџџwc”Dжччй-E—ЏAеЯ,.0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;ЩћцPџџџџ ЩˆЩ‘ €џџџџwc”Dжччй-E—ЏAеЯ,.0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц`џџџџ ЩˆЩ‘ €џџџџwc”Dжччй-E—ЏAеЯ,.0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцpџџџџ ЩˆЩ‘ €џџџџwc”Dжччй-E—ЏAеЯ,.0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц€џџџџ ЩˆЩ‘ €џџџџwc”Dжччй-E—ЏAеЯ,.0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцџџџџ ЩˆЩ‘ €џџџџwc”Dжччй-E—ЏAеЯ,.0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцџџџџ ЩˆЩ‘ €џџџџx›”іЯ™#iAЙcїљž›0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцрџџџџ ЩˆЩ‘ €џџџџx›”іЯ™#iAЙcїљž›0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц№џџџџ ЩˆЩ‘ €џџџџx›”іЯ™#iAЙcїљž›0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцџџџџ ЩˆЩ‘ €џџџџx›”іЯ™#iAЙcїљž›0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцџџџџ ЩˆЩ‘ €џџџџx›”іЯ™#iAЙcїљž›0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц џџџџ ЩˆЩ‘ €џџџџx›”іЯ™#iAЙcїљž›0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц0џџџџ ЩˆЩ‘ €џџџџx›”іЯ™#iAЙcїљž›0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц@џџџџ ЩˆЩ‘ €џџџџx›”іЯ™#iAЙcїљž›0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;ЩњцPџџџџ ЩˆЩ‘ €џџџџx›”іЯ™#iAЙcїљž›0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц`џџџџ ЩˆЩ‘ €џџџџx›”іЯ™#iAЙcїљž›0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцpџџџџ ЩˆЩ‘ €џџџџx›”іЯ™#iAЙcїљž›0KKMORW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц€џџџџ ЩˆЩ‘ €џџџџx›”іЯ™#iAЙcїљž›0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцџџџџ ЩˆЩ‘ €џџџџx›”іЯ™#iAЙcїљž›KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц`џџџџ ЩˆЩ‘ €џџџџvJ”Кџ`‰JK‚a7џИT E0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцpџџџџ ЩˆЩ‘ €џџџџuJ”Кџ`‰JK‚a7џИT E0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц€џџџџ ЩˆЩ‘ €џџџџuJ”Кџ`‰JK‚a7џИT E0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцџџџџ ЩˆЩ‘ €џџџџuJ”Кџ`‰JK‚a7џИT E0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцџџџџ ЩˆЩ‘ €џџџџvf^)8_yЩщM‰ЛБрEч0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцрџџџџ ЩˆЩ‘ €џџџџvf^)8_yЩщM‰ЛБрEч0KKMOSW[_isssw{ƒ—ЁЋЛVФOмŠТGЅB;Щћц№џџџџ ЩˆЩ‘ €џџџџvf^)8_yЩщM‰ЛБрEч0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцџџџџ ЩˆЩ‘ €џџџџvf^)8_yЩщM‰ЛБрEч0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцџџџџ ЩˆЩ‘ €џџџџvf^)8_yЩщM‰ЛБрEч0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц џџџџ ЩˆЩ‘ €џџџџvf^)8_yЩщM‰ЛБрEч0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц0џџџџ ЩˆЩ‘ €џџџџvf^)8_yЩщM‰ЛБрEч0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц@џџџџ ЩˆЩ‘ €џџџџvf^)8_yЩщM‰ЛБрEч0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;ЩћцPџџџџ ЩˆЩ‘ €џџџџvf^)8_yЩщM‰ЛБрEч0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц`џџџџ ЩˆЩ‘ €џџџџvf^)8_yЩщM‰ЛБрEч0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцpџџџџ ЩˆЩ‘ €џџџџvf^)8_yЩщM‰ЛБрEч0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћц€џџџџ ЩˆЩ‘ €џџџџvf^)8_yЩщM‰ЛБрEч0KKMOSW[_isssw{ƒ—ЁЋЛVФOм‰ТGЅB;Щћцџџџџ ЩˆЩ‘ €џџџџvf^)8_yЩщM‰ЛБрEчN–9уєNѓ@Ѓ cќyt˜œDDDDDD`dp`t```h`hhpd`p@@@@@@@@ap`ppp``@@@@@@@@DDDDDDDD@@@@@@@@DDDDDDDDDDDDDDDDDDDDDDDD`p```pddDDDDDDDDpp`apc`ddddbd p`p``ppdppDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDpd`p`0p DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD@@ p`p`p`pDDDDDDDDDDDDDDDD@@@@@@@@DDDDDDDDDDDDDDDD@@@@@@@@@@@@@@@@`p`p`p`p`p`p`p`p`p`p`p````````p`p`p`p`p````````pDDDDDDDD@@@@@@@@`p`p`0hpppdp`pcpDDDDDDDDDDDDDDDD@@@@@@@@DDDDDDDD@@@@@@@@@@@@@@@@DDDDDDDDDDDDDDDD`h```h`apd``````@@@@@@@@@@@```p0 0`p``00 0``p`p00 @@@@@@@@DDDDDDDDDDA@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@DDDDDDDD@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@DDDDDDDD@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@A@@@@@@@@@@@@DDDDDDDD@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@`ZcіyRiўџџ?^8№ЄцШ ўŽћџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџО` Zcіwt^8Р@О`Zcіyšr^80О`Zcі^8О`[ ёlбЗHA№0 †№Whttp://www.w3.org/2001/XMLSchema0џŸš№%anyType0jeXЕ№1anySimpleType0јtZN№#string0ћ˜§№%boolean0ђ№›m№!float0CЕИў№#double0Ту:= №%decimal0x S №'duration0CёSZ №'dateTime0хvš №time0ez˜ №date0Я=0№+gYearMonth0єp9{№!gYear0ŽŠ*№)gMonthDay0љ0ё №gDay0TЙћн№#gMonth0o›ѕ№)hexBinary0ѓИx№/base64Binary0Gj5я№#anyURI0рvи№!QName0jY№'NOTATION0sM"№7normalizedString0щђњM№!token0“єa~№'language0хvи №Name0‘tи9№#NCName0Ф$№ID0ТЂ”˜№!IDREF0uh’ъ№#ENTITY0ЃиѓI №%NMTOKEN0…UИL!№%integer0ђ5 ђ"№;nonPositiveInteger0 щ”#№5negativeInteger0gї› $№long0tw%№int0sљ=&ё!short0ez^ '№byte0Š5aЃ(№;nonNegativeInteger0№їZ )№/unsignedLong0uѕA/*№-unsignedInt0ЅВ›н+№1unsignedShort0ђzŸЁ,№/unsignedByte0rщOХ-№5positiveInteger0aQJ.№#IDREFS0wXš/№'ENTITIES0їQьљ0№'NMTOKENS0Џњч1№http://schemas.microsoft.com/sqlserver/2004/sqltypes0уn ˆ2№_http://www.w3.org/XML/1998/namespace0…&U 3№/xmlSpaceEnum0If,=4№1sqlDbTypeEnum0šSЌb5№AsqlCompareOptionsEnum0ƒc6№AsqlCompareOptionsList0ђ0z 7№char0є0zь8№!nchar0§ы{,9№%varchar0§ыЇ,:№'nvarchar0t|™;№text0r|™ю<№!ntext0oВы=№)varbinary0ozи>№#binary0уsИ?№!image0пСKJ@№)timestamp0к_A№7timestampNumeric0MНмB№%numeric0btњœC№#bigint0zР}ЭD№'smallint0:Є;яE№%tinyint0єДF№bit0ьpYG№real0CёS^I№'datetime05In5I№1smalldatetime0џВћнJ№!money0І80K№+smallmoney0››7L№7uniqueidentifier0ь6M№xml0Šњ-N№'dbobject0gw˜ O№lang0тq>P№!space0хyX Q№base0CЪ}YR№)sqlDbType0•‰q+S№-clrTypeName00T№)maxLength0њл@U№'localeId0v—~ЁV№9sqlCompareOptions0V–‡_W№=sqlCollationVersion0z–ОX№)sqlSortId0bvxŠ R ЈV]Ю аЗ ˜‰CЃA’ lз5 Љ V дЪёK Ф# k $я-ѕh Ђ H Ъ|Г|Is cТ< xлмc@|FЅ7|и•eSpecs PФx›”yš”Ÿ5а4Ad-^W!N Ю3hbЇE„Д Щ‹d-^W!N Ю3hbЇE„іЯ™#iAЙcїљž›cЯŸт ря\шdЈGЙŸ2Чv!н` Z,і Юђ^R8О`'™9 ЮзJС#0'X Ѓцqš Ѓцqš ў—http://schemas.microsoft.com/SQL/ServiceBroker/Error0'E 3Ѓцqš3Ѓцqš ўŸhttp://schemas.microsoft.com/SQL/ServiceBroker/EndDialog0'X 3Ѓцqš3Ѓцqš ўЏhttp://schemas.microsoft.com/SQL/Notifications/QueryNotification0'X 3Ѓцqš3Ѓцqš ўЏhttp://schemas.microsoft.com/SQL/Notifications/EventNotification0'E 3Ѓцqš3Ѓцqš ўЃhttp://schemas.microsoft.com/SQL/ServiceBroker/DialogTimer0'X 3Ѓцqš3Ѓцqš ўйhttp://schemas.microsoft.com/SQL/ServiceBroker/BrokerConfigurationNotice/MissingRoute0'X 3Ѓцqš3Ѓцqš ўзhttp://schemas.microsoft.com/SQL/ServiceBroker/BrokerConfigurationNotice/FailedRoute0'X 3Ѓцqš3Ѓцqš ўїhttp://schemas.microsoft.com/SQL/ServiceBroker/BrokerConfigurationNotice/MissingRemoteServiceBinding0' X 3Ѓцqš3Ѓцqš ўѕhttp://schemas.microsoft.com/SQL/ServiceBroker/BrokerConfigurationNotice/FailedRemoteServiceBinding0' N 3Ѓцqš3Ѓцqš ў­http://schemas.microsoft.com/SQL/ServiceBroker/ServiceEcho/Echo0' X 3Ѓцqš1Ѓцqš ўЛhttp://schemas.microsoft.com/SQL/ServiceBroker/ServiceDiagnostic/Query0' X 3Ѓцqš3Ѓцqš ўНhttp://schemas.microsoft.com/SQL/ServiceBroker/ServiceDiagnostic/Status0' N 3Ѓцqš3Ѓцqš ўЧhttp://schemas.microsoft.com/SQL/ServiceBroker/ServiceDiagnoqtic/Description0'N 3Ѓцqš3Ѓцqš ў=DEFAULT0'3Ѓцqš3Ѓцqš ўЗhttp://schemas.microsoft.com/SQL/Notifications/PostQueryNotification0'3Ѓцqš3Ѓцqš ўЗhttp://schemas.microsoft.com/SQL/Notifications/PostEventNotification0'3Ѓцqš3Ѓцqš ўПhttq://schemas.microsoft.com/SQL/ServiceBroker/BrokerConfigurationNotice0'3Ѓцqš3Ѓцqš ўЃhttp://schemas.microsoft.com/SQL/ServiceBroker/ServiceEcho0'8Ѓцqš8Ѓцqš ўЏhttp://schemas.microsoft.com/SQL/ServiceBroker/ServiceDiagnostic0'8Ѓцqš8Ѓцq™ ў=DEFAULT0'<Ѓцqš<Ѓцqš ўНhttp://schemas.microsoft.com/SQL/Notifications/QueryNotificationService0'AЃцqšAЃцqš ўНhttp://schemas.microsoft.com/SQL/Notifications/EventNotificationService0'JЃцqšJЃцqš ўЇhttp://schemas.microsoft.com/SQM/ServiceBroker/ServiceBroker’ел , ‰ Ъ  \  X ›р3>Gp—єE–ї` Zј ^ 8Р`СWЇ Юэ0<”>Lь===GAutoCreatedLocalLOCAL8Р`Сu‰Юѓ&)AutoCreatedLocalќ2Sќ€p`"&˜xXyšO "PР"LР"LР"№Р"єР"юР"=Р"™(Р"™(Р"™(Р"™(Р"љ5Р"ѕ5Р"ѕ5Р"ТР":$Р":$Р"œEР"œEР"ЫEР"ЫEР"ЫEР" нEР" ЫEР" нEР!Р"Р"Р"Р" Ѕ€Р" Ѕ€Р" Ѕ€Р" Ѕ€Р" Ѕ€Р" Ѕ€Р" Ѕ€Р" Ѕ€Р" Ѕ€Р" Ѕ€Р" Ѕ€Р" Ѕ€Р" Ѕ€Р" Ѕ€Р" Ѕ€Р"=Р"д(Р"д(Р"д(Р"д(Р"д(Р"д(Р"д(Р" д(Р"Р"Р"Р"Р"Р"Р"Р"Р" Р" Р"В(Р"В(Р"В(Р"Р"Р"Р"UР"Р"Р"Р"Р" Р"ЋР"ЋР"ЋР"ЋР"ЋР"ЋР"ЋР""pР""pР""pР""pР""œР""pР""pР""pР"" ˆР"" pР"" Р")вР")вР")вР")вР")вР")вР")вР")вР") вР") вР") вР") вР") вР")вР")вР")ж@Р",Р",Р",Р",Р",Р",Р",Р",Р".Р".Р".tР".Р". Р".аР".Р".@Р". Р"1 Р"1 Р"1 Р"1 Р"1 PР"2Р"2Р"2Р"2Р"2Р"2Р"2Р"2Р"2 Р"2 Р"2 Р"2 Р"2 Р"3Р"3Р"3Р"3Р"3Р"3Р"3Р"3Рx  x 8$—    8$—ˆ ( ˆ 8$— А  8$—˜ 8 ˜ 8$—  Р  8$—3щФŸzU0 цСœwR-уО™tO*рЛ–qL'нИ“nI$џкЕkF!ќзВhCљдЏŠe@і б Ќ ‡ b =  ѓ Ю Љ „ _ :  № Ы І  \ 7  э Ш Ѓ ~ Y 4  ъ Х   { V 1 чТxS. фПšuP+сМ—rM(оЙ”oJ%лЖ‘lG"§иГŽiDњеА‹fAїв­ˆc>єЯЊ…`'[ќ.yš“š5 '='U'd''  ='U''d''Ћ'""h'))R',,'..'11 '22'33'66ž'77'::'<<Ъ'@@'AA'CC'DD'EE'GG'HH'II'JJ‘'KK№'LL'NN'ZZ['[[]'\\a']]'^^'__'``'aa'ЪяГxЪяГx''""h'))R',,'..'22'33'66ž'::'@@'CC'EE'JJ‘'KK№'NN'ZZ['[[]']]'__'``'aa''""h'..'22'CC'EE'__'``'""h'..'ьc('ьc('^KK*'^KK*'а“3,'а“3,'( r’$') r’$'* ,§i1'+ ˜йv8', Bм.'- Bм.'. r’$'/ r’$'0 ,§w1'1 ˜й‡8'2 Bм.'3 Bм.'4 r’$'5 r’$'6 ,§†1'7 ˜й’8'8 Bм.'9 Bм.': r’$'; r’$'< ,§”1'= ˜йЁ8'> Bм.'? Bм.'@ r’$'A r’$'B ,§–1'C ˜йЄ8'D Bм.'E Bм.'F r’$'G r’$'H ,§—1'I ˜йЄ8'J Bм.'K Bм.'L r’$'M r’$'N ,§Ќ1'O ˜йЮ8'P Bм.'Q Bм.'R r’$'S r’$'T ,§Л1'U ˜йр8'V Bм.'W Bм.'X r’$'Y r’$'Z ,§У1'[ ˜йу8'\ Bм.'] Bм.'^ r’$'_ r’$'` ,§У1'a ˜йу8'b Bм.'c Bм.'ў r’$'џ r’$' ,§1' ˜й§7' Bм.' Bм.' r’$' r’$' ,§1' ˜й 8' Bм.' Bм.' r’$' r’$' ,§11' ˜й.8' Bм.'Bм.' r’$' r’$' ,§91' ˜й58' Bм.' Bм.' r’$' r’$' ,§:1' ˜й68' Bм.' Bм.' r’$' r’$' ,§:1' ˜й68' Bм.'! Bм.'" r’$'# r’$'$ ,§U1'% ˜й]8'& Bм.'' Bм.'( r’$') r’$'* ,§U1'+ ˜й]8', Bм.'- Bм.'. r’$schema_vкА†\2оДŠ`6,  и Ў „ Z 0  м В ˆ ^ 4 р Ж Œ b 8  ф К  f <  шО”j@ьТ˜nD№ЦœrHєЪ vL"јЮЄzP&ќвЈ~T*жЌ‚X.кА†\2оДŠ`)#l Ь \Я‹ ) €) 8 €) 8 €) 8 €) €) 4 €) €) 0 €) 8 €) 8 €) 8 €) 8 €) 4€) €) €) 0 €)  €) 8 €) 4€) ­€) ­!€) ­'€) - €) 5 €) = €) 8 €) 4€) яа4 €) яа4 €)  €)  8 €)  8 )  4€)  0€)  4€)  0€)  0€) 8  €) 4 €) 4! €) 0# €) 0$ €)  4%€) !4'€) €) 8 €) 0€) 4€) 8 €) 4€) 4€) 4€)  €) 8 €) 8 €) 8 €) Џ€)=€)=€) !€) 8 )€) ­- €) ­5 €) 0€) €)  €) 8 €) ча4џџ€) Џ€)ЅUўџ€)Ѕ§џ€)ча4ќџ€) 8 €) = €) = €) 0€) 8 €) 9 €) 8 €) 8 €) Џ€) Џ€)" 8 €)" ча4џџ€)" 8 €)" 0 €)" 8 €)" Џ€)" 8 €)" 0€)" 8  €)" = €)" =$ €)) 8 €)) 4€)) 8 €))ча4џџ€)) 0€)) 8 €)) 4€)) 0€)) 0 €)) 8  €)) 8  €)) 4 €)) 8 ! €)) 8 %€)) 8 )€/еЈ{N!єЧšm@цЙŒ_2иЋ~Q$їЪpCщ М  b 5  л Ў  T ' њ Э   s F  ь П ’ e 8 о Б „ W * §аЃvIяТ•h;сД‡Z-гІyLђХ˜k>фЗŠ]0жЉ|O"ѕШ›nAчК`%[W…yt›š5E%%" ў%*' ў% IE ў%# ў% -) ў% )% ў% A= ў% ў% Œ ў% ў%" @," ў%)ƒ-) ў%,8%, ў%. д+ . ў%1r  1 ў%2 E12 ў%3 6"3 ў%6 ;'6 ў%77 ў%: /' : ў%<u< ў%@6#@ ў%AA ў%C C ў%DЇ) R D ў%E E ў%G# G ў%H63H ў%I3ГI ў%JJ ў%KK ў%LјL ў%N$!N ў%ZWZ ў%[ i! [ ў%\W\ ў%]c] ў%^z0 ^ ў%_ V( _ ў%`>! ` ў%aa ў%ЪяГxv^ЪяГx ў%   ў%" " ў%) ) ў%, , ў%.  . ў%2  2 ў%3 3 ў%6 6 ў%: : ў%@  @ ў%C  C ў%E E ў%JJ ў%KK ў%NN ў%Z  Z ў%[[ ў%]  ] ў%_  _ ў%`  ` ў%a a ў%ag ў%" " ў%.‘. ў%2  2 ў%C C ў%E  E ў%_)+_ ў%`%+ ` ў%"  " ў%.)). ў%XЌ0d0ьc( ў%H/5/5ьc( ў%XЌ0d0^KK* ў%H/5/5^KK* ў%XЌ0d0а“3, ў%H/5/5а“3, ў% ZF r’$ ў% Z@= r’$ ў% ZW,§ ў% Z H0˜й ў% Y  Bм. ў%   Bм. ў% ZF r’$ ў% Z@= r’$ ў% ZW,§ ў% Z H0˜й ў% Y  Bм. ў%!   Bм. ў%" ZF r’$ ў%# Z@= r’$ ў%$ ZW,§ ў%% Z H0˜й ў%& Y  Bм. ў%'   Bм. ў%( ZF r’$ ў%) Z@= r’$ ў%* ZW,§ ў%+ Z H0˜й ў%, Y  Bм. ў%-   Bм. ў%. ZF r’$ ў%/ Z@= r’$ ў%0 ZW,§ ў%1 Z H0˜й ў%2 Y  Bм. ў%3   Bм. ў%4 ZF r’$ ў%5 Z@= r’$ ў%6 ZW,§ ў%7 Z H0˜й ў%8 Y  Bм. ў%9   Bм. ў%: ZF r’$ ў%; Z@= r’$ ў%< ZW,§ ў%= Z H0˜й ў%> Y  Bм. ў%?   Bм. ў%@ ZF r’$ ў%A Z@= r’$ ў%B ZW,§ ў%C Z H0˜й ў%D Y  Bм. ў%E   Bм. ў%F ZF r’$ ў%G Z@= r’$ ў%H ZW,§ ў%I Z H0˜й ў%J Y  Bм. ў%K   Bм. ў%L ZF r’$ ў%M Z@= r’$ ў%N ZW,§ ў%O Z H0˜й ў%P Y  Bм. ў%Q   Bм. ў%R ZF r’$ ў%S Z@= r’$ ў%T ZW,§ ў%U Z H0˜й ў%V Y  Bм. ў%W   Bм. ў%X ZF r’$ ў%Y Z@= r’$ ў%Z ZW,§ ў%[ Z H0˜й ў%\ Y  Bм. ў%]   Bм. ў%^ ZF r’$ ў%_ Z@= r’$ ў%` ZW,§ ў%a Z H0˜й ў%b Y  Bм. ў%c   Bм. ў%ј ZF r’$ ў%љ Z@= r’$ ў%њ ZW,§ §%ћ Z H0˜й ў%ќ Y  Bм. ў%§   Bм. ў%ў ZF r’$ ў%џ Z@= r’$ ў% ZW,§ ў% Z H0˜й ў% Y  Bм. ў%   Bм. ў% ZF r’$ ў% Z@= r’$ ў% ZW,§ ў% Z I0˜й ў% Y  Bм. ў%   Bм. ў% ZF r’$ ў% Z@= r’$ ў% ZW,§ ў% Z H0˜й ў% Y  Bм. ў%   Bм. ў% ZF r’$ ў% Z@= r’$ ў% ZW,§ ў% Z H0˜й ў% Y  Bм. ў%   Bм. ў% ZF r’$ ў% Z@= r’$ ў% ZW,§ ў% Z H0˜й ў% Y  Bм. ў%   Bм. ў\3 сИf=ыТ™о Е Œ c :  ш П – m D  ђ Щ   w N % ќ г Њ  X /  нД‹b9чО•lCёШŸvM$ћвЉ€W.мГŠa8цН”kB№ЧžuL#њбЈV-лВ‰`EkGуyš’š5BE$л јEг јE јE    јE   й јEп јE јEжжз јE––— јEœœ јE""­JЎ јE))ЂІЃ  јE,,zzА јE11QQR јE22nnx јE33 јE66ОП јE77м@н јE<<ЕЗЖ319 јE@@’’“ јEAA јEJJVVW јEKKžžŸ јELLTTU јEЪяГxЪяГxj\i јE˜˜™ јE""ЏЏА јE))ЄЉЅ јE,,RR  јE22ВВQ јE33 јE66ааб јE@@””• јEJJ‘ јEKK  Ё јEšš› јE""ББВ јE22yyГ јE""ГГД јE<џ<''( јE˜йџa __hci јEЪяГxџЪяГxkkl јE:  # јE:ZZ| јEa јEa јEN јEN јE Z! јE ZXXv јE [""Y јE[ww{ јE\ДДS јE]&&] јE]вви јEC јEC јEC јEG јEE  $ јEE[[ јEE% јED јE D јE"H јE$I јE&^ јE'^ јE). јE*. јE+. јE,. јE-. јE/_ јE0_ јE1_ јE2_ јE4` јE5` јE6` јE7 јE8 јE9 јE: јE; јE< јE= јE> јE? јE@ јEA јEB јEEb  јEЯX ~~Ж јEаY ддC јEбZ hHVTa јEв[ (ˆTџ  јEг\ uuЕ јEд\  јEе] PPе јEж^ BBI јEз_ SS јEи`  ~VTa јEйa €Жџ  јEкb ддC јEлb  јEмc HHT јEж^ BBI šQПv-ф›R Рw.хœS Сx/цT Тy0чžU Уz1шŸV Ф{2щ WХ|3ъЁXЦ}4ыЂYЧ ~ 5 ь Ѓ Z  Ш  6 э Є [  Щ € 7 юЅ\Ъ8яІ]Ы‚9№Ї^Ьƒ:ёЈ_Э„;ђЉ` ZіЯИ^8О`џ<(жа‹  vIЋЊцqš;;ОИz?dхj;TŒх:TŒх:TŒх:ИИ~EЯAРDќŠ~A€@@€@"%Рё =d‹Жн#LwЂЧъH{Њп A j Ї а ї  3 T u Ђ у I n  В з њ  > e † Ѕ Ъ э  I j ‘ Д л %PyІЭђBeŒЏиџ&Szв(MnАЯј6[€Ѓдћ Kp‘Кх=f…Ас+V}ЄЧьB‡Мс-XyžНр6[zЇЬѓ?dВйќHq”НьBe‚ЁЪы +Pw˜Щь<uІЭ№#Jq”Ед§:e„ЃФч / V y Є Э ю !.!Y!|!!О!п!0Р@€?1@chObjectType0€@€?/@iActionFlag0A€?@id0@€?'@iObject0@€?'@iresult0€@€?+@iVCSFlags0@€?'@iWhoToo0@€?%@lvalue0€?€?!@name0A€?)@property0@€?+@txStream10@@@+@txStream30@€?%@uvalue0€@€?#@value0Р@€?-@vchComment0@A€?1@vchLoginName0Р@€?3@vchObjectName0@A€?/@vchPassword0@€?5@vchProjectName0@€?€?9@vchSourceSafeINI0€?€?€?)algorithm0€?€?€?)backuplsn0@@€?=binary_message_body0€?€?€?)bitposint0€?€?€?'brkrinst0€?€?cert0@€?ahk0PA€?!class0€?€?!colid0€@€?-collationid0@@@€?Aconversation_group_id0@@€?=conversation_handle0€?€?)convgroup0р@€?%created0€?€?€?!crend0€?€?€?#crrows0€?€?€?%crstart0€?€?€?#crtype0@@@€?#defval0@@€?!depid0@€?'depsubid0€?€?!deriv0@@€?dflt0€?€?%dfltsch0@€?#diagid0€?€?€?-diffbaselsn0€?€?€?/diffbasetime0€?€?€?!dlgid0€?€?€?'dlgtimer0@€?#Doc_ID0@€?'Doc_Lang0@€?%Doc_NUM0@€?%Doc_Org0@€?+Doc_Status0@€?)Doc_Title0€?€?€?-Domain_Name0@€?€?'encrtype0€?€?€?%enqtime0€?€?€?-farbrkrinst0€?€?€?#farsvc0€?€?€?#fgidfs0€?€?'fileguid0@€?#fileid0€?€?€?)filestate0€?€?'filetype0@€?'fillfact0€=€?€?-firstoorder0€?€?€?'forkguid0€?€?€?#forkvc0@@€?5fragment_bitmap0@@€?1fragment_size0€?€?€?%fromsvc0€?€?€?%grantor0€?€?€?!grpid0€?€?guid0@€?#handle0@€?hash0€?€?€?)hdrseclen0@@€?#hobtid0ЈA€?id0€@€?%idmajor0@€?%idminor0€?€?#idtval0@€?1IhsSession_ID0€?€?'imageval0@@€?%indepid0@€?+indepsubid0€?€?%indexid0@€?!indid0@€?)initiator0€?€?€?+inseskeyid0€?€?3internalstatus0A€?%intprop0€?€?€?)ItemCount0@€?kind0€?€?€?+lastoorder0€?€?€?1lastupdatelsn0€@€?#length0@€?'lifetime0@@@@€?+Login_Date0 @€?'Login_ID0€?€?€?'maxinrow0€?€?€?#maxint0€?@@€?%maxsize0@€?+Media_type0@@€?+message_id0@@€?Emessage_sequence_number0@@€?5message_type_id0€?€?€?%minleaf0€?€?€?%miraddr0A€?'modified0€?€?€?+msgbodylen0€?€?€?!msgid0€?€?€?%msgtype0A€?name0€?€?#nameid0@@€?1next_fragment0€?€?€?%nmscope0€?€?%nsclass0@@€?nsid0€?€?€?-nullbitleaf0€?€?€?%numpart0€?€?'objectid0@€?!objid0€?€?€?+offsetleaf0€?€?€?%ordinal0€?€?€?)outseskey0€?€?€?%ownerid0€?€?€?'password0€?€?€?#pclass0€?€?€?#pcused0@@@?)PER_EMAIL0@€?)PER_FNAME0€@€?#Per_ID0@€?)PER_LNAME0€?€?/PER_PASSWORD0€?€?€?1PER_UPDATE_BY0€?€?€?%pgfirst0€?€?€?#pgroot0€?€?pid0@€?pkey0€?€?€?)placingid0€?€?!pname0€@€?prec0@€?!Price0€?€?%princid0@@€?'priority0€?€?€?!pukey0@@@€?1queuing_order0€?€?€?#rcrows0€?€?€?#rcvseq0€?€?€?-readonlylsn0€?€?€?9redostartforkguid0€?€?€?1redotargetlsn0€?€?'refcount0@@@#Req_ID0@€?8АУO`6~~б<Ћ№Ћ№ОE'(№Я к иЫ @@—ЇиЫ @@—рЇиЫ @@—иЫ @@—АЇиЫ @@—€ЇиЫ @@—PЇЇ@@—€Ї@@—И~№Я иЫ @@— ЇиЫ @@—иЫ @@—иЫ @@—№ ЇиЫ @@—иЫ @@—Р ЇАЇ@@— Ї@@—И~№Я иЫ @@—€>ЇиЫ @@—P>ЇиЫ @@— >ЇиЫ @@—№=ЇиЫ @@—Р=ЇиЫ @@—аЇ@@—РЇ@@—И~№Я и иЫ @@—=ЇиЫ @@—`=ЇиЫ @@—иЫ @@—0=ЇиЫ @@—=ЇиЫ @@—а<Ї№Ї@@—рЇ@@—И~№Я иЫ @@— <ЇиЫ @@—иЫ @@—иЫ @@—p<ЇиЫ @@—иЫ @@—@<Ї ЌЂ@@—ЌЂ@@—И~wЇ Ї0Ї@ЇPЇ`ЇpЇ€ЇЇиЫ @`Ё ЇиЫ @`ЁАЇиЫ @`ЁРЇиЫ @`ЁаЇиЫ @`ЁрЇиЫ @`Ё№Ї`дІЇЇpдІ@`ЁИ~ Ї0Ї@ЇиЫ @`ЁPЇиЫ @`Ё`ЇиЫ @`ЁpЇиЫ @`Ё€ЇиЫ @`ЁЇиЫ @`Ё Ї@дІАЇРЇPдІ@`ЁИ~аЇрЇ№ЇиЫ @`ЁЇиЫ @`ЁЇиЫ @`Ё ЇиЫ @`Ё0ЇиЫ @`Ё@ЇиЫ @`ЁPЇ дІ`ЇpЇАдІ@`ЁИ~€ЇЇ ЇиЫ @`ЁАЇиЫ @`ЁРЇиЫ @`ЁаЇиЫ @`ЁрЇиЫ @`Ё№ЇиЫ @`ЁЇ€дІЇ ЇдІ@`ЁИ~0Ї@ЇPЇиЫ @`Ё`ЇиЫ @`ЁpЇиЫ @`Ё€ЇиЫ @`ЁЇиЫ @`Ё ЇиЫ @`ЁАЇ`2ЇРЇаЇ ЄЂ@`ЁИ~рЇœ]й  &Їй ј%Їй а%Ї№Я и иЫ @@—0ЇиЫ @@—иЫ @@—иЫ @@—ЇиЫ @@—иЫ @@—аЇ№Ї@@—рЇ@@—И~№Я иЫ @@— ЇиЫ @@—` ЇиЫ @@—0 ЇиЫ @@— ЇиЫ @@—а ЇиЫ @@—Ї@@—Ї@@—И~№Я иЫ @@—  ЇиЫ @@—p ЇиЫ @@—иЫ @@—@ ЇиЫ @@— ЇиЫ @@—аЇ0Ї@@— Ї@@—И~№Я и иЫ @@— ЇиЫ @@—иЫ @@—иЫ @@—pЇиЫ @@—иЫ @@—@ЇPЇ@@—@Ї@@—И~№Я иЫ @@—<ЇиЫ @@—аЇиЫ @@— ЇиЫ @@—pЇиЫ @@—@ЇиЫ @@—pЇ@@—`Ї@@—И~Єй  й  й  й  й  й  й  й  й  й  й  й  й  й  й  иrй  й  й  й  ?й  й  Єй  й  й  й  hй  й  й  й  й  й  й  й  й  &ёй  й  й  й  й  й  й  й  œ](С ˆУ@ тІ K—ŽŽиЫ @`Ё№ ЇиЫ @`Ёр ЇиЫ @`Ёˆ8Ÿ№Я ўџџиЫ @@— ЇиЫ @@—pЇиЫ @@—@ЇиЫ @@—ЇиЫ @@—аЇиЫ @@—PЇ@@—@Ї@@—И~№Я 2ЇиЫ @@— ЇиЫ @@—pЇиЫ @@—иЫ @@—@ЇиЫ @@—ЇиЫ @@—рЇpЇ@@—`Ї@@—И~№Я иЫ @@—АЇиЫ @@—иЫ @@—иЫ @@—€ЇиЫ @@—иЫ @@—PЇЇ@@—€Ї@@—И~№Я Р иЫ @@—ЇиЫ @@—рЇиЫ @@—АЇиЫ @@—€ЇиЫ @@—PЇиЫ @@—АЇ@@— Ї@@—И~№Я `ЁиЫ @@— ЇиЫ @@—№ЇиЫ @@—иЫ @@—РЇиЫ @@—ЇиЫ @@—`ЇаЇ@@—РЇ@@—И~Єй  й  й  й  й  й  `rЉй  PsЉй  й  й  й  й  й  й  й  й  й  й  й  й  й  œ]№Я иЫ @@—АтІиЫ @@—€тІиЫ @@—иЫ @@—PтІиЫ @@— тІиЫ @@—№сІАЇ@@— Ї@@—И~№Я иЫ @@—РсІиЫ @@—иЫ @@—иЫ @@—сІиЫ @@—иЫ @@—`сІаЇ@@—РЇ@@—И~№Я иЫ @@— ЇиЫ @@—№ЇиЫ @@—РЇиЫ @@—ЇиЫ @@—`ЇиЫ @@—№Ї@@—рЇ@@—И~№Я иЫ @@—0ЇиЫ @@—ЇиЫ @@—иЫ @@—аЇиЫ @@— ЇиЫ @@—pЇЇ@@—Ї@@—И~№Я ЇиЫ @@—@ЇиЫ @@—иЫ @@—иЫ @@—ЇиЫ @@—иЫ @@—ауІ0Ї@@— Ї@@—И~o` ZзіxM*^S8ъМО`-7<LлР0 U l ƒ š Б Ш п і €?€?A€? @€? @€?@@€?@@€?@@€?€?€?€?€?€?€? €?€? @€? €?€? €?€? €?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€? €?€?!€?€?d€?€?e€?€?f€?€?g€?€?h?€?i€?€?j€?€?k€?€?l€?€?m€?€?n€?€?o€?€?p€?€?q€?€?r€?€?s€?€?t€?€?u€?€?v€?€?w€?€?x€?€?y€?€?Ш€?€?Щ€?€?Ъ€?€?€?€?,€? A€?B€?€?D€?€?E€?€?F€?€?G€?€?H€?€?I€?€?h€?€?|€?€?}@€?@@€?@@€?@@@@@@€?@@€?@@€?@@€? @€?€?@@€?]Ж!€?€?ьc(€?€?€?а“3,0UlƒšБШпі $;Ri€—ЎХмѓ !8Of}”ЋТй№ B€?@€?€?€?€?€?€?€?@@€?˜A€? 0A€?€?€?€?€?€?€? @€?@€?€@€=€?€?€?€?1€?€?2€?€?d@@€?e€?€?g@@€?h€?€?j€?€?k€?€?l@@€?m€?€?n@@€?p@€?q@@@t€?€?u€?€?v€?€?w€?€?x€?€?I€?€?|€?€?@€?€?@€?€?@€? @€? @@€?,§€?€?˜й@€?Гоn'@@@—o?+0ЁъФЦ @@€?wшК €@€?А Џ €@€?"U—@@@”@€?ЭСs@@€?? \€@€@€@БRD€@€?ъv8@A€?Ю €@€?–)Њ"€@€?ЯMž#€?€?u\{@@€?Ў€„|Р@€?чЄx}@@€? Щl~ @€?Yэ`0€@ C€@| 7NeC€?@@€?€?€?€?@@€?Щ0€@ C€@]/FC€?@€?€?€?ll  _WA_Sys_Requested_date_75D7831F”\и и рXАЄШш(, ` @ЬXШШШШШШШШШШШШЬєЌЌ ЈАЂ1э `H-<RЂouФ€0<@$И`Њцqš?€= @€A€?€@8$€?€?pA€?20<<$Ф$\ЬžиžЪЪЋЊЊ> ,0<У7Ђ;У7Ђ;PAJC€?€@€@€@ T<,@0B€?€?€?C€?<OЅ"ž@i@D`UUе?€@€@њЦЂ‚@i@Ф `UUе?Ž@Ž@jЊцqš€`@’`UUе?№–@и•@э*ЄС?0<< @$ $\ЬžиžЪЪЎGa? ,0<GG€@JC€@ ™ 8Of}”ЋТй№5Lcz‘ЈПжэ2I`wŽЅМгъ/F]t‹ЂЙачў,CZqˆŸЖЭфћ)@Wn…œГЪсј&=Tk‚€?€?@@€?@@€?€?€? €?€?€?€?€?€?€@€?р@€?A€?"0A€?)€@€?,€@€?.€@€?1€@€?2@€?3Р@€?6Р@€?7 @€?: @€?<€@€?@€?€?A@@€?C€?€?D@@€?E€?@€?I @€?J@€?K @€?L@€?N@€?Z@€?[€?€?\@€?]€?€?^@@@@@@`@€?a€?€?f€?€?’U€?€?€?Z=€?€?€?vЂ%€?€?€?шъ €?€?€?Z3і€?€?€?Ь{о €?€?€?>ФЦ €?€?€?А Џ €?€?€?"U—€?€?€?”€?€?€?цg€?€?€?x.P€?€?€?ъv8€?€?Ю €@€?,§€?€?ytх0A€?˜й€?€?ыМЭ€?€?–)Њ"€?€?ЯMž#@€?r’$@€?ьc(@@@а“3,€?€? И'-@@€?Bм.€?€?эHј0€?€?€?_‘р2€?€?€?бйШ4€?€?€?C"Б6€@€?ЪяГx€?@€?Ў€„|€?€?€? Щl~€?€?Yэ`SЅ"ž@i@DG`†?€@€@џЦЂ‚@i@Ф G`†?Ž@Ž@ zђqš@c@Ј@ †aˆ?˜–@и•@=ј8іnс?0<< @$~$\ЬžиžЪЪ€?ЭЬL=€@JC€@ їˆŸЖЭфћ)@Wn…œГЪсјр@€?ЊB€?шA€?@A€? @€?€?€?€?@€?€?€?€? €?€? ˆA€? `A€?  A€? р@€?€@€?@€?€?€?€?€?€?SЅ"ž@i@D ™™Љ?€@€@џЦЂ‚@i@Ф  ™™Љ?Ž@Ž@%zђqš`c@Љ А?@”–@и•@џ`JQз?0<< $$\ЬžиžЪЪ€?€@JC€@ JC€?SЅ"ž@i@D№?€@€@џЦЂ‚@i@Ф №?Ž@Ž@)zђqš€c@Њ№?–@и•@0<<@$Џ%aЬžиžЪЪ]tQ?ЋЊЊ<''5AJC5A ?'8Yz›Мнў@a‚ЃФх'HiŠЋЬэ/Pq’Гдѕ7XyšЛм§0B€?!0 A€?!08B€?!0@€?!0@@€?!0€?€?!0€@€?! 0Р@€?!0@€?!0@@€?!0 @€?!0@€?!0€@€?!0€?€?!80@@@!]0€?€?!c0р@€?!e0€?€?€?!0€?€?!ƒ0 @€?!Š0€?€?€?!š0Р@€?!0@€?!к00A€?!Л0@@@!:0€?€?! 0@€?!Л0€?€?€?!*0€?€?€?!h0€?€?€?!Ђ0€@€?!$0@€?!'0@@€?!х0€@€?!ы0@€?!:#0€?€?€?!K+0€?€?!V10р@€?!n10€?€?€?!SЅ"ž@i@ ' ˆЩ•?ј? @ @hs,wм?ЧЂ‚@i@v (@сz”?ј?ЈŽ@ЈŽ@ЕЛ&Фšїо?.zђqš c@  љЌ›?№?2—@~–@%бs pш?/ ыа ! ‚ ` >  њ и ,`ѓdхмI<ўoŒH0<6$ BЭžиžžž€?a 6 ‡ а bЋє=†ЯaЊя8Ц\Љю3vЫц&a|™ЖгQŒСњ;|0€?€?I_WA_Sys_00000001_0000004A0€?€?I_WA_Sys_00000001_2E1BDC420€?€?I_WA_Sys_00000002_000000070€?€?I_WA_Sys_00000002_0000001D0€?€?I_WA_Sys_00000002_000000290€?€?I_WA_Sys_00000002_0000002C0€?€?I_WA_Sys_00000002_000000310€?€?I_WA_Sys_00000002_000000360€?€?I_WA_Sys_00000002_000000370€?€?I_WA_Sys_00000002_0000003A0€?€?I_WA_Sys_00000002_0000003C0€?€?I_WA_Sys_00000002_000000400€?€?I_WA_Sys_00000002_0100004C0€?€?I_WA_Sys_00000002_78B3EFCA0€?€?I_WA_Sys_00000003_000000050€?€?I_WA_Sys_00000003_000000070€?€?I_WA_Sys_00000003_0000001B0€?€?I_WA_Sys_00000003_0000001D0€?€?I_WA_Sys_00000003_000000220€?€?I_WA_Sys_00000003_000000290€?€?I_WA_Sys_00000003_000000310€?€?I_WA_Sys_00000003_0000003A0€?€?I_WA_Sys_00000003_0000003C0€?€?I_WA_Sys_00000003_0000004A0€?€?I_WA_Sys_00000003_0000004C0€?€?I_WA_Sys_00000003_78B3EFCA0€?€?I_WA_Sys_00000004_001000050€?€?I_WA_Sys_00000004_0000001D0€?Р@€?I_WA_Sys_00000004_0000003C0€?€?I_WA_Sys_00000005_0000001D0€?€?I_WA_Sys_00000005_000000220€?€?I_WA_Sys_00000005_000000290€?€?I_WA_Sys_00000005_000000370€?€?I_WA_Sys_00000005_0000003C0€?€?I_WA_Sys_00000005_000000400€?€?I_WA_Sys_00000005_0000004A0€?€?I_WA_Sys_00000005_78B3EFCA0€?€?I_WA_Sys_00000006_0000001D0€?€?I_WA_Sys_00000006_000000220€?€?I_WA_Sys_00000006_000000290€?€?I_WA_Sys_00000006_000100370€?€?I_WA_Sys_00000007_0000001D0€?@€?I_WA_Sys_00000007_000000370€?@€?I_WA_Sys_00000009_000000360€?€?I_WA_Sys_0000000B_000000290€?€?I_WA_Sys_0000000C_0000004C0€?€?I_WA_Sys_0000000D_000000290€?€?I_WA_Sys_0000000D_0000004C0€?€?I_WA_Sys_0000000E_000000290€?€?I_WA_Sys_0000000F_000000290€?€?E_WA_Sys_Doc_ID_1ED998B20€?€?I_WA_Sys_Doc_Lang_1ED998B20€?€?G_WA_Sys_Doc_NUM_1ED998B20€?€?G_WA_Sys_Doc_Org_1ED998B20€?€?M_WA_Sys_Doc_Status_1ED998A20€?@€?I_WA_Sys_Login_ID_1ED998B20€?€?M_WA_Sys_Media_type_1ED998B20€?€?E_WA_Sys_Per_ID_1BFD2C070€?€?E_WA_Sys_Per_ID_1ED998B20€?€?C_WA_Sys_Price_1ED998B20€?€?U_WA_Sys_Requested_date_1ED998B20A€?cl0АA€?clst0A€?!clust0€?€?;IX_ExcludedDomains0Р@€?nc0pA€?nc10р@€?nc20@@€?nc30€?€?IPK__sysdiagrams__2F10007B0€?€?5pk_dtproperties0€?€?;PK_ExcludedDomains0€?€?5PK_LastLoggedOn0€?€?9PK_RequestedItems0@@€?Aqueue_clustered_index0@@€?Aqueue_secondary_index0€?€?9UK_principal_nameџ((z_WA_Sys_00000002_0000003A3_000000224_0000001D5_000000296_00000037C_0000004CIhsSession_ID_1BFD2C07clstustnc1PK_LastLoggedOn@РР   # - 7 AKСaƒceРh‚jk4€Ѕ"žРc@:M lС†?€@€@RЩЂ‚Рc@К M lС†?Ž@Ž@}ЊцqšX@ $IЂ?№?N@а–@и•@s+‹šЈEу?ў?€= €@~C€@“h–­Флђ  7Ne|вB€?šB€?ЈA€?р@€?@@@@@@@@@ @A€? A€? Р@€? @@€?@€?€?€?0<7 `"0<7 @$О{ђqšџџ?€@C€@>'dB€?FC€?0<7  "БнСЮ Ъ`?<( e[УО0<2$—‹Њцqš€?&Д=&Д=&Д=0Ё­AиA_B[A€@€@Илў:a†ЇШх +\ƒЎлHmЄЭђ0€?€?#bigint0€?€?#binary0€?€?bit0€?€?char0€?€?'datetime0€?€?%decimal0€?€?!float0€?€?!image0€?€?int0€?€@€?'nvarchar0€?€?real0€?€?1smalldatetime0€?€?'smallint0€?€?+smallmoney0€?€?-sql_variant0€?€?%sysname0€?€?text0€?€?)timestamp0€?€?%tinyint0€?€?7uniqueidentifier0€?€?)varbinary0€?€?%varchar0€?€?xmlџ ((Hbigintchardecimalncharvarcharsmalldatetimeql_varianttextuniqueidentifier@ РР  *480<3"0<3"0<2 $Аг’іŽš€?й‰=€?иA€?0 ДШм№,@Th|ЄИЬрє€?€?"€?€?€?$€?€?0€?€?€?8€?@€?<€?€?€?>€?€?b€?€?c€?€?h€?€?€?l€?€?z€?€?€?€?Ѕ€?€?Ї€?€?­€?€?Џ€?€?Н@€?ч€?€?я€?€?ё0<6$—‚#р0шœžž%I?/Ї{ЧT<{ЧTФЦ @€?А Џ €@€?"U— @€?[y‹ A€?”р@€?ЭСs@€?цg@@@@@@x.P@€?БRD€@€?ъv8ИA€?Ю €@€?,§@A€?˜йр@€?–)Њ"€@€?ЯMž#@€?r’$pA€?ьc(pApApAа“3,р@€?ЪяГx€?€?u\{€@€?чЄx}@@@Yэ`0<)$H€ЛIhj&'0<,$œ™Њцqš€?€? @€?€?€@€?€?0<,$чЊцqš€?€?€?€?pA€?Р@€@€?€@%_0€?€?sysџ((sys@0<.@"0<."0<."0<."0<1"0<2$ХЊцqš&Д=€@иA€@Eия4KbyЇОеь1H_vЄЛвщ.€?€?"€?€?#€?€?$€?€?0€?€?4€?€?8€?€?:€?€?;€?€?<€?€?=€?€?>€?€?b€?€?c€?€?h€?€?j€?€?l€?€?z€?€?€?€?Ѕ€?€?Ї€?€?­€?€?Џ€?€?Н€?€?ч€?€?я€?€?ё€?€?0<2$Ÿ†Њцqš€?&Д=&Д=0Ё­AиA€@_B[A€@иA€?0<) `"0<) @$КЛhЛцqš;;?@РD@:%яC€?КB€?0<)  "0<) $AЛ;Мцqš;;!=€@РD€@Сј&=Tk‚™АЧоѕ #:Qh–­Флђ  7Ne|“ЊšB€?”B€?€B€?lB€?HB€?(B€?B€?рA€?РA€? ˜A€? €A€? PA€?  A€? A€?A€? @€?€@€?€@€?€@€?€@€?@@€?@@€?@@€?B€?@€?@€?€?€?€?€?€?€?€?€?€?€?0<)  "`(фАxLмЄp0в ыЩЇ…c| р Аo“˜ `:<Ц ьХ0<"$†eАЊцqš]]€? ,0<::€@КB€@ачў,CZqˆŸЖЭфћ)@Wn…œГЪсј&=Tk‚™АЧоѕ #:Qh–­Флђ  7Ne|“ЊСия€?€?€?@€?€?€? €?€?€?€?€?€?€?€?€?€?€?€?)€?€?,€?@@€?3€?€?6€?€?7€?€?:€?€?<€?€?@€?@@€?E€?€?G€?€?H€?€?I€?€?J€?€?K€?€?€?N€?€?Z€?€?[€?€?\€?€?^€?€?^€?€?_€?€?`€?€?a€?€?’U€?€?€?Z=€?€?€?vЂ%€?€?€?шъ €?€?€?Z3і€?€?€?Ь{о €?€?€?>ФЦ €?€?€?А Џ €?€?€?"U—€?€?€?”€?€?€?цg€?€?€?x.P€?€?€?ъv8€?€?Ю €?€?€?@Pё€?€?€?˜й€?€?€?$сС €?€?€?–)Њ"€?€?€?r’$€?€?€?zКz&€?€?€?ьc(€?€?€?^KK*€?€?€?а“3,€?€?ЪяГx€?€?€?<8œz€?€?€?Ў€„|€?€?€? Щl~€?€?Yэ`0<"$œeЕЊцqš]]€?? ,0< ,0<'š$BКB€?€@'šB€@КB€?0<" "0<" "Є ‚ ц`*<таYТ40<"$œeЕЊцqš]]€?? ,0< ,0<'š$BКB€?€@'šB€@КB€?0<" "0<" "0<"$'eЙЊцqš]]€? ,0< ,0< ,0< ,0<[['š$BКB'šB€@€?€@iŸи+pЧM„Уњ5nЋф!bЃрV•м'lЕ ; z Н  5 h Ÿ к X  к  > s Ў у  k В љ @sЎп 7hКх?fИсAh•ОчKt›Фї._Š­р 4kšЯў3`•Оћ(0€?€?SDF__dtpropert__versi__7A9C383C0€?€?EDF_LoginLogs_Login_Date0€?€?WDF_RequestedItems_Requested_date0€?€?Adt_addtosourcecontrol0€?€?Edt_addtosourbecontrol_u0€?€?7dt_adduserobject0€?€??dt_adduserobject_vcs0€?€?7dt_checkinobject0€?€?;dt_checkinobject_u0€?€?9dt_checkoutobject0€?€?=dt_checkoutobject_u0€?€?9dt_displayoaerror0€?€?=dt_displayoaerror_u0€?€?Adt_droppropertiesbyid0€?€?Adt_dropuserobjectbyid0€?€?=dt_generateansiname0€?€?9dt_getobjwithprop0€?€?=dt_getobjwithprop_u0€?€??dt_getpropertiesbyid0€?€?€?Gdt_getpropertiesbyid_vcs0€?€?Kdt_getpropertiesbyid_vcs_u0€?€?Edt_isundersourcecontrol0€?€?Idt_isundersourcecontrol_u0€?€?Kdt_removefromsourcecontrol0€?€?;dt_setpropertybyid0€?€??dt_setpropertybyid_u0€?€?Cdt_validateloginparams0€?€?Gdt_validateloginparams_u0€?€?1dt_vcsenabled0€?€?3dt_verstamp0060€?€?7dt_whocheckedout0€?€?;dt_whocheckedout_u0€?€?/dtproperties0€?€?OEventNotificationErrorsQueue0€?€?5ExcludedDomains0€?€?MFK_RequestedItems_LoginLogs0€?€?;IX_ExcludedDomains0€?€?)LoginLogs0€?€?5pk_dtproperties0€?€?;PK_ExcludedDomains0€?€?5PK_LastLoggedOn0€?€?9PK_RequestedItems0€?€?OQueryNotificationErrorsQueue0€?€?Gqueue_messages_6615773950€?€?Gqueue_messages_6935775090€?€?Gqueue_messages_7255776230€?€?3RequestedItems0€?€?;ServiceBrokerQueue0€?€?1sysallocunits0€?€?-sysasymkeys0€?€?+sysbinobjs0€?€?1sysbinsubobjs0€?€?'syscerts0€?€?+sysclsobjs0€?€?+syscolpars0€?€?/sysconvgroup0€?€?+sysdbfjles0€?€?'sysdercv0€?€?)sysdesend0€?€?)sysfiles10€?€?)sysftinds0€?€?-sysguidrefs0€?€?3syshobtcolumns0€?€?'syshobts0€?€?-sysidxstats0€?€?)sysiscols0€?€?€?)sysnsobjs0€?€?5sysobjkeycrypts0€?€?/syrobjvalues0€?€?)sysowners0€?€?'sysprivs0€?€?)sysqnames0€?€?3sysremsvcbinds0€?€?7sysrowsetcolumns0€?€?1sysrowsetrefs0€?€?+sysrowsets0€?€?#sysrts0€?€?3sysscalartypes0€?€?+sysschobjs0€?€?)sysserefs0€?€?7syssingleobjrefs0€?€?/syssqlguides0€?€?5systypedsubobjs0€?€?/sysxmitqueue0€?€?5sysxmlcomponent0€?€?-sysxmlfacet0€?€?5sysxmlplacement0€?€?)sysxprops0€?€?=VWCountItemsByLogin0€?€?-VWPer_Login0€?€>AVWRequestITEMS_Clientџ((йDF__dtpropert__versi__7A9C383Ct_checkinobjectdropuserobjectbyidgetpropertiesbyid_vcsvalidateloginparamsEventNotificationErrorsQueuePK_ExcludedDomainsRequestedItemssysclsobjsfiles1multiobjrefsremsvcbindsschobjsxmlfacet@Р@ -?Tgƒ•@ЃІ­ Г ПЪб0<"$YeОЊцqš]]€?>> ,0<AКB€@€?€@й8Of~”ЋТЂB€?@€?,§@@€?˜й@€?r’$€?€?Гоn'€?€?€?—o?+@€?ЪяГx0<"  "Рg@`(:<™ЋьХA@0<$еУЊцqš€?€= €@€A€@UXo†ДЫтљ'>€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?€?@€?€?@€?€?@€? @€? @0<$ъШЊцqš€=€=ЭA€A­A€@Jb€Ѓж@qžз7n‹ЎЯ -0€?€?#client0€?€?3db_accessadmin0€?€?9db_backupoperator0€?€?1db_datareader0€?€?1db_datawriter0€?€?-db_ddladmin0€?€?9db_denydatareader0€?€?9db_denydatawriter0€?€?'db_owner0€?€?7db_securityadmin0€?€?dbo0€?€?#eSpecs0€?€?!guest0€?€?;INFORMATION_SCHEMA0€?€?#public0€?€?sysџ ((Tclientdb_backupoperatordatawriterdladminenydatawriterownerguestINFORMATION_SCHEMAsys@РР Р ! (5:?Q0<$EЬЊцqš€?‰ˆˆ=€= НA€A@A€@ХH`xЋоDwž0€?€?0€?€?0€?€?€?3 @0€?€?€?3 @0€?@€?3 @0€?€?€?3  @0€?€?3 0ЌА )]@*!^ž‹‚0€?€?'|к‰TrSI QOћMо­з0€?€?'ањУёЩKВS-xO0™0<$И8ОЊцqš88? зЃ< зЃ<й‰<й‰<%I’<ЈA`B€?€@€@€@€@€@8$@@€?TB€?0<  "0< $ћЙyђqš?€?€A€?8s$ A€?RР@€?Sџ ((RS@†0<  "0< $O ZгњФš€?Вй;QQ€@C€@Я ˆŸЖЭфћ)@Wn…œГЪсј&=Tk‚™АЧоѕ #:Qh–­Флђ  7Ne|“ЊСия4KbyЇОеь1H_vЄЛвщ  . E \ s Š Ё И €?€?ўџџ€?€?ўџџ€?€?€?ўџџ€?€?€?ўџџ€?€?€?!ўџџ€?€?€?#ўџџ€?€?$ўџџ€?€?+ўџџ€?€?€?-ўџџ€?€?€?/ўџџ€?€?€?1ўџџ€?€?€?3ўџџ€?€?€?5ўџџ€?€?€?7ўџџ€?€?€?9ўџџ€?€?€?;ўџџ€?€?€?=ўџџ€?€?€??ўџџ€?€?€?Aўџџ€?€?€?Cўџџ€?€?€?Eўџџ€?€?€?Gўџџ€?€?€?Iўџџ€?€?€?Kўџџ€?€?€?Mўџџ€?€?€?Oўџџ€?€?€?Qўџџ€?€?€?Sўџџ€?€?€?Uўџџ€?€?€?Wўџџ€?€?€?Yўџџ€?€?€?[ўџџ€?€?€?]ўџџ€?€?€?_ўџџ€?€?€?aўџџ€?€?€?cўџџ€?€?€?eўџџ€?€?€?gўџџ€?€?€?iўџџ€?€?€?kўџџ€?€?€?mўџџ€?€?€?oўџџ€?€?€?qўџџ€?€?€?sўџџ€?€?€?uўџџ€?€?€?wўџџ€?€?€?yўџџ€?€?€?{ўџџ€?€?€?}ўџџ€?€?€?ўџџ€?€?pџџџ€?€?€?rџџџ€?€?€?tџџџ€?€?€?vџџџ€?€?€?xџџџ€?€?€?zџџџ€?€?€?|џџџ€?€?€?~џџџ€?€?џџџ€?€?•џџџ€?€?€?—џџџ€?€?€?™џџџ€??€?›џџџ@@€?€?€?’U€?€?€?Z=€?€?€?vЂ%€?€?€?шъ €?€?€?Z3і€?€?€?Ь{о €?€?€?>ФЦ €?€?€?А Џ €?€?€?"U—€?€?€?”€?€?€?цg€?€?€?x.P€?€?€?ъv8 @€?ЪяГx€?€?u\{€?€?€?чЄx}€?€?€?Yэ`0<  "0< $ŸcгњФš€?€@C€@C€?0<  "0< $ќ’гњФš€>€@C€@| 7NeC€?€?€?€?€?€?€?0< "pdXL@4(јьрDфиАhPЄ˜ŒЬдt€\№М8Ш ‰Ь[d > 5`l €eSpecs_Data D:\DATABASE\data\eSpecs_Data.MDF B€eSpecs_Log D:\DATABASE\log\eSpecs_Log.LDF x` Z і!Юш ^8О`!] uб "Яї!†@8!TNN ј! TZR ј!TPR ј!TPR ј!TPR ј!TPR ј! TPR ј! TPR ј! TPR ј! TPR ј! TPR ј!TPR ј!TPR ј!TPR ј!TPR ј!TPR ј!TPR ј!TPR ј!TPR ј! TPR ј!!TPR ј!dTSR ј!eTSR ј!fTSR ј!gTSR ј"hTSR ј!iTSR ј!jTSR ј!kTSR ј!l TSR ј!m!TSR ј!n"TSR ј!o#TSR ј!p$TSR ј!q%TSR ј!r&TSR ј!s'TSR ј!t(TSR ј!u)TSRј!v*TSR ј!w+TSR ј!x,TSR ј!y-TSR ј!Ш.TLR ј!Щ/TLR ј!Ъ0TLR ј!3TSR ј!,4TSR ј!-5TSR ј!.6TLN ј!/7TSR ј!08TSR ј!19TSR ј!2:TSR ј!3;TSR ј!4<TSR ј!5=TSR ј!6>TSR ј!7?TSR ј!8@TSR ј!9ATSR ј!: TSR ј!;BTSR ј!<CTSR ј!=%TSR ј!>DTSR ј!?EVSR ј!@FTSR ј!ATSR ј!BGTSR ј!DHTSR ј!EITSR ј!FJTSR ј!GKTSR ј!HLTSR ј!IMTKR ј!hNTSR ј!OAAN ј!PAAN ј!QAAN ј!iRAAN ј!jSAAN ј!kTAAN ј!lUAAN ј!mVAAN ј!nWAAN ј!oXAAN ј!pYAAN ј!qZAAN ј!r[AAN ј!s\AAN ј!|M|MNS ј!}N}WNP јname&status&path&tableid&rowinfo&ftkey& !schema_ver& -stats_schema_ver&type&userstat&sysstat&indexdel&refdate&version&deltrig&instrig&updtrig&seltrig&category&cache&maxlen&rows&status&type&usertype&printfmt&prec&scale&!iscomputed&!isoutparamt&!isnullable&collation& %tdscollation& usertype&variable&!allownulls&type&printfmt&prec&scale&collation&texttype&language&encrypted& !compressed& text& depdbid& depsiteid& selall& resultobj& readobj&fkeydbid& rkeydbid& fkey1& fkey2& fkey3& fkey4&fkey5&fkey6&fkey7&fkey8&fkey9&fkey10&fkey11&fkey12&fkey13&fkey14&fkey15&fkey16&rkey1&rkey2&rkey3&rkey4&rkey5&rkey6& rkey7&!rkey8&"rkey9&#rkey10&$rkey11&%rkey12&&rkey13y&'rkey14&(rkey15&)rkey16& gid& environ& #hasdbaccess& islogin& isntname& isntgroup& isntuser& issqluser& isaliased& issqlrole& isapprole&id&indid&colid&keyno&constid&fkeyid&rkeyid&fkey&rkey&keyno&memberuid&groupuid&id&uid&action&#protecttype&columns&grantor&_fileid&_groupid&_size&_maxsize&_growth&_status&_perf&_name&_ filename&­:яssegment&­:яsname&­:яsstatus&ц^уtconstid&ц^уtid&ц^уtcolid&ц^уtspare1&ц^уtstatus&ц^уtactions&ц^уterror&ƒзuReq_ID&ƒзuPer_ID&ƒзuDoc_ID&ƒзuDoc_NUM&ƒзuDoc_Title&K/base_schema_ver& L#isaliased&!T!@iObject&2Д'collationidЌ ‡ b =  ѓ Ю Љ „ _ :  № \ 7  э Ш Ѓ ~ Y 4  ъ Х   { V 1 чТxS. фПšuP+І Ы  сМ—rM(оЙ”oJ%лЖ‘lG"§иГŽiDњеА‹fAїв­ˆc>єЯЊ…` Zі#ЮO5^ 8О` Zі$Юз^^ 8TEО` Zі%Ю№^8†О`Aoo&Я] €.-Рi,РjРkpРlqРm.РnqРoqРpxРqxРrРsРI|Р|}џџџРРfРР88 РТ 8У ˜Т €4 У €4ŽˆxФ  € €ћ@џџœ† 88 @џџд† 88 @џџ ‡ ЇЇа4@џџT‡ ЅЅ@џџœ‡ ЅЅ@џџф‡ 88 ИУ иУ јУ Ф 8Ф XФ lŒhХ  € €ћ@џџЄ‰ 88 @џџм‰ 88 @џџŠ ЇЇа4@џџ\Š ЅЅ@џџЄŠ 88 ШФ шФ Х (Х HХ Ш‘ћD44(“ћˆ  ’ћeчча4ј’ћD44H@’ћD44˜”ћeча4•ћHЅЅU˜•ћHЅЅ—ћD44АS І dn˜јУ  Р Ln˜јУ n˜јУ 44ЅЅUџџџџ44uidstatusnamesidЅrolesџџcreatedateupdatedate altuidpasswordИ›ћˆ 0›ћeчча4ˆ›ћD44HlŒ Ь  € €ћ@џџєm88 @џџ,n88 @џџdnЇЇа4@џџМnЅЅ@џџo88 €Ы  Ы РЫ рЫ Ь lŒщџџџЭ  € €ћ@џџФp88 @џџќp88 @џџ4qЇЇа4@џџ|qЅЅ@џџФq88 pЬ Ь АЬ аЬ №Ь lŒЮ  € €ћ@џџ„s88 @џџМs88 @џџєsЇЇа4@џџDtЅЅ@џџŒt88 `Э €Э  Э РЭ рЭ lŒ№Ю  € €ћ@џџLv88 @џџ„v88 @џџМvЇЇа4@џџ wЅЅ@џџTw88 PЮ pЮ Ю АЮ аЮ lŒрЯ  € €ћ@џџy88 @џџLy88 @џџ„yЇЇ а4@џџдyЅЅ@џџz88 @Я `Я €Я  Я РЯ lŒаа  € €ћ@џџм{88 @џџ|88 @џџL|ЇЇа4@џџЄ|ЅЅ@џџь|88 0а Pа pа а Аа lŒРб  € €ћ@џџЌ~88 @џџф~88 @џџЇЇ а4@џџlЅЅ@џџД88 б @б `б €б  б lŒАв  € €ћ@џџœ 88 @џџl— 88 @џџЄ— ЇЇ а4@џџє— ЅЅ@џџќ› 88 в 0в Pв pв в lŒ г  € €ћ@џџœ 88 @џџд 88 @џџ ž ЇЇа4@џџdž ЅЅ@џџЌž 88 г  г @г `г €г lŒд  € €ћ@џџќ  88 @џџ4Ё 88 @џџlЁ ЇЇа4@џџФЁ ЅЅ@џџ Ђ 88 №г д 0д Pд pд ncsysusers2 @№Aшj˜№б  Р ncsysusers1@ №Aшj˜г  Р €џџ‰ јв Hо јв Hо `џ №п ph0@њ(8јв о ип Р №пѓЕ–wX9ћмНžд`P1О'@6 Ќ'ytš5б40'E E ј5nc20'G G ј7clst0'H H ј3cl0'I I ј3cl0'J J ј7clst0'J J ј5nc10'K K ј7clst0'K K ј5nc10'L L ј7clst0'L  јa_WA_Sys_00000002_0000004C0'L  јa_WA_Sys_00000003_0000004C0'L  јa_WA_Sys_0000000D_0000004C0'N N ј3cl0'N N ј3nc0'Z Z ј7clsu0'Z Z ј5nc10'[ [ ј3cl0'[ [ ј5nc10'\ \ ј3cl0'] ] ј3cl0'] ] ј5nc10'^ ^ ј3cl0'_ _ ј3cl0'_ _ ј5nc10'_ _ ј5nc30'` ` ј7clst0'` ` ј5nc10'` ` ј5nc20'a a ј7clst0'a a ј5nc10',§ ј]_WA_Sys_Per_ID_1BFD2C070',§ јe_WA_Sys_Login_Date_1BFD2C070',§ јk_WA_Sys_IhsSession_ID_1BFD2C070'˜й јa_WA_Sys_Login_ID_1ED998B20'˜й ј]_WA_Sys_Per_ID_1ED998B20'˜й ј]_WA_Sys_Doc_ID_1ED998B20'˜й ј__WA_Sys_Doc_NUM_1ED998B20'˜й ј[_WA_Sys_Price_1ED998B20'˜й јm_WA_Sys_Requested_date_1ED998B20'˜й јe_WA_Sys_Media_type_1ED998B20'˜й  ј__WA_Sys_Doc_Org_1ED998B20'˜й  јe_WA_Sys_Doc_Status_1ED998B20'˜й  јa_WA_Sys_Doc_Lang_1ED998B20'ьc(  јYqueue_clustered_index0'ьc(  јYqueue_secondary_index0'^KK*  јYqueue_clustered_index0'^KK*  јYqueue_secondary_index0'а“3,  јYqueue_clustered_index0'а“3,  јYqueue_secondary_index0'ЪяГx+ЪяГx јMpk_dtproperties0'J  јa_WA_Sys_00000001_0000004A0'J  јa_WA_Sys_00000003_0000004A0'J  јa_WA_Sys_00000005_0000004A0'ЪяГx јa_WA_Sys_00000002_78B3EFCA0'ЪяГx јa_WA_Sys_00000003_78B3EFCA0'ЪяГx јa_WA_Sys_00000005_78B3EFCA0'Bм. јa_WA_Sys_00000001_2E1BDC420'L јa_WA_Sys_0000000C_0000004C<',§+Z јMPK_LastLoggedOn<'˜й+Z јQPK_RequestedItems<'Bм.+ јaPK__sysdiagrams__2F10007B<'Bм.K јQUK_principal_name<'r’$+Z јSPK_ExcludedDomains<'r’$KZ јSIX_ExcludedDomains<',§+Z јMPK_LastLoggedOn<'˜й+Z јQPK_RequestedItems<'Bм.+ јaPK__sysdiagrams__2F10007B<'Bм.K јQUK_principal_name<'r’$+Z јSPK_ExcludedDomains<'r’$KZ јSIX_ExcludedDomains<',§+Z јMPK_LastLoggedOn<'˜й+Z јQPK_RequestedItems<'Bм.+ јaPK__sysdiagrams__2F10007B<'Bм.K јQUK_principal_name0'r’$+Z^  јSPK_ExcludedDomains0'r’$KZ_  јSIX_ExcludedDomains0',§+Z`  јMPK_LastLoggedOn0'˜й+Za  јQPK_RequestedItems0'Bн.+b  јaPK__sysdiagrams__2F10007B0'Bм.Kc  јQUK_principal_name<'Bм.K јQUK_principal_name<'r’$+Z јSPK_ExcludedDomains<'r’$KZ јSIX_ExcludedDomains<',§+Z јMPK_LastLoggedOn<'˜й+Z јQPK_RequestedItems<'Bм.+ јaPK__sysdiagrams__2F10007B<'Bм.K јQUK_principal_name<'r’$+Z јSPK_ExcludedDomains<'r’$KZ јSIX_ExcludedDomains<',§+Z јMPK_LastLoggedOn<'˜й+Z јQPK_RequestedItems<'Bм.+ јaPK__sysdiagrams__2F10007B<'Bм.K јQUK_principal_name<'r’$+Z јSPK_ExcludedDomains<'r’$KZ јSIX_ExcludedDomains0',§+ZN  јMPK_LastLoggedOn0'˜й+ZM  јQPK_RequestedItems0'Bм.+P  јaPK__sysdiagrams__2F10007B0'Bм.KQ  јQUK_principal_name0'r’$+ZR  јSPK_ExcludedDomainsй  й Wі•%И[њЬ s  С h  ЖЎ I ъ …  Н ^  ЄCЉиs\сЊu@ дŸl9бži6Ъ—dЂA еž4гri2џЬ•`)<f’(а 0< $“ эпЊцqš55ЭЬL>ШeE<`ќч:QQ@A@ DA€@ ˆЃОйє*E`{–БЬч8Sn‰ЄПкѕ+Fa|—ВЭш9ToŠЅРлі,Gb}˜ГЮщ:Up‹ІСмї - H c ~ ™ Д Я ъ  ; V q Œ Ї Т н ј Р@€?A€?0A€?€@€?pA€? A€? A€?@@€?A€?р@€?0A€?"€A€?)A€?,A€?. @€?1PA€?2@A€?30A€?6р@€?7A€?:Р@€?<A€?@ @€?A @€?C A€?Dр@€?E€@€?G @€?HаA€?IР@Р@Р@KјA€?L @€?N€@€?Z@A€?[ @€?\р@€?]Р@€?^A€?_A€?`Р@€?a€@€?,§@A€?˜й@€?r’$р@€?ЪяГx@€?€@€@€@)€@€?,@€?.@@€?2€@€?3@@€?6€@€?:@@€?@@€?C@@€?E @€?J @€?K€@€?N@@€?Zр@€?[@@€?]@€?_@€?`€@€?a@€?r’$@€?€@€?"@@€?.@@€?2@@€?C@€?E@€?_€@€?`@@€?"@€?.pA€?Р@€?pA€?Р@€?pA€?Р@€?0<$Љ ƒжЊцqšSS€?ШeE<CCAІBA) 3Ni„ŸКе№ &A\w’­Шуў4Oj… Лжё 'B]x“ЎЩфџ5Pk†ЁМзђ (C^y”ЏЪх6Ql‡ЂНиѓ €?€?€?€?€?€?€?€?€?€? €?€?€?€?€?€?€?€?€?€?€?"€?€?)€?€?,€?€?.€?€?1€?€?€?3€?€?6€?€?7€?€?:€?€?<€?€?@€?€?A€?@€?E€?@€?I€?€?€?K€?€?L€?€?N€?€?Z€?€?€?\€?€?€?^€?€?€?`€?€?a€?€?,§€?€?˜й€?€?r’$€?€?ЪяГx€?€?€?€?€?)€?€?,€?€?.€?€?2€?€?3€?€?6€?€?:€?€?@€?€?C€?€?E€?€?J€?€?K€?€?N€?€?Z€?€?[€?@@€?a€?€?r’$€?€?€?€?"€?€?.€?€?2€?€?C€?€?E€?€?_€?€?`€?€?"€?€?.€?€?€?€?€?€?€?€?€?€?0<"0<$дšбЊцqš``ЋЊЊ>ЋЊ*<ЋЊ*<ˆAРB€?AAT,@ A€?ІB€?@@€?Рs–ˆš  Аz ==Ž |——0  444иE |——0  чча4џч Є 0` d—0  44|——0  88 88$—Рs–0  Hš  { ==ИŒ Ѓ—0  ==иСЄ0€ Рs–0  HŽ  44€• |——0  88 8p$—0` Ѓ—0  44ЌУЄЃ—0  ==иСЄ0€  ` d p h l м˜hФаŒHќМОœѓ `.(<ё )hЎ0<$5 ’пЊцqš``€?ЋЊ*<GGAРBAЕ 8Sn‰ЄПкѕ+Fa|—ВЭш9ToŠЅРлі,Gb}˜ГЮщ:Up‹ІСмї-Hc~™ДЯъ ;VqŒЇТнј . I d  š €?€?€?€?€?€?€?€?€?€? €?€?€?€?€?€?€?€?€?€?€?"€?€?)€?€?,€?€?1€?€?€?3€?€?6€?€?7€?€?<€?€?@€?€?A€?€?J€?€?€?L€?€?,§€?€?˜й€?€?r’$€?€?ЪяГx€?€?€?€?€?)€?€?,€?€?2€?€?3€?€?6€?€?€?J€?€?K€?€?r’$€?€?€?€?"€?€?2€?€?"€?€?<џ€?€?˜йџ€?€?ЪяГxџ€?€?€?€?€?€?€?€?€?€?€?€?€?€? €?€? €?€? €?€?€?€?€?€?€?€?@€?€?@@€?€?€?€?€? €?€?€?$€?€?&€?€?'€?@€?+€?€?€?-€?@€?1€?€?2€?@€?6€?€?€?8€?€?€?:€?€?€?<€?€?€?>€?€?€?@€?€?€?B0< $x:#LGМбžddЋЊЊ>€?ШB€? T№,@ЊB€?0A€?€@€?^ 4‹žY@Ъ`UUе?€{@€{@6ЗщЌ›Y@š`UUе?0Џ@0Џ@0< $ќ :#LGМбžddлЖm?СР@<HHAШBA и t @[v‘ЌЧт§3Ni„ŸКе№ &A\w’­Шуў4Oj… Лжё 'B]x“ЎЩфџ5Pk†ЁМзђ (C^y”ЏЪх  6 Q l ‡ Ђ Н €?€?€?€=€?€?€?€?€?€? €?€?€?€?€?€?€?€?€?€?€?"€?€?)€?€?,@€?.€?€?1€?€?€?3€?€?6€?€?7€?€?:@€?<€?€?@€??A€?€?C@€?D€?€?E€?@€?I€?€?€?K€?€?L€?€?N€?€?Z€?€?€?\€?€?]@@@_€?€?€?a@€?ЪяГx€?€?€?€?€?)€?€?,€?€?.€?€?2€?€?3€?€?6€?€?:€?€?@€?€?C€?€?E€?€?J€?€?K€?€?N€?€?Z€?€?[€?@@€?a€?€?€?€?"€?€?.€?€?2€?€?C€?€?E€?€?_€?€?`€?€?"€?€?.@@€?€?€?@@€?€?€?@@€?€?€?€?€?ў €?€?€? @€? @@€? €?€? ^ 4‹žY@ЪH ˆ?"@€{@€{@Ьf˜zрц?:ЗщЌ›Y@šI ˆ?"@0Џ@0­@yАŒ>эр?€?ШB€? T№,@ЊB€?0A€?€@€?^ 4‹žY@Ъ`UUе?€{@€{@6ЗщЌ›Y@š`UUе?0Џ@0Џ@„I@ќOshX,АлQвшќOX,Ј§Oц(рOœцOЅШ§Op§OЅЅX,(рOџO@џO˜Pт • `+<р*аm Б0<"$'eЙЊцqš]]€? ,0< ,0< ,0< ,0<[['š$BКB'šB€@€?€@iŸи+pЧM„Уњ5nЋф!bЃрV•м'lЕ ; z Н  5 h Ÿ к X  к  > s Ў у  k В љ @sЎп 7hКх?fИсAh•ОчKt›Фї._Š­р 4kšЯў3`•Оћ(0€?€?SDF__dtpropert__versi__7A9C383C0€?€?EDF_LoginLogs_Login_Date0€?€?WDF_RequestedItems_Requested_date0€?€?Adt_addtosourcecontrol0€?€=Edt_addtosourcecontrol_u0€?€?7dt_adduserobject0€?€??dt_adduserobject_vcs0€?€?7dt_checkinobject0€?€?;dt_checkinobject_u0€?€?9dt_checkoutobject0€?€?=dt_checkoutobject_u0€?€?9dt_displayoaerror0€?€?=dt_displayoaerqor_u0€?€?Adt_droppropertiesbyid0€?€?Adt_dropuserobjectbyid0€?€?=dt_generateansiname0€?€?9dt_getobjwithprop0€?€?=dt_getobjwithprop_u0€?€??dt_getpropertiesbyid0€?€?€?Gdt_getpropertiesbyid_vcs0€?€?Kdt_getpropertiesbyid_vcs_u0€?€?Edt_isundersourcecontrol0€?€?Idt_isundersourcecontrol_u0€?€?Kdt_removefromsourcecontrol0€?€?;dt_setpropertybyid0€?€??dt_setpropertybyid_u0€?€?Cdt_validateloginparams0€?€?Gdt_validateloginparams_u0€?€?1dt_vcsenabled0€?€?3dt_verstamp0060€?€?7dt_whocheckedout0€?€?;dt_whocheckedout_u0€?€?/dtproperties0€?€?OEventNotificationErrorsQueue0€?€?5ExcludedDomains0€?€?MFK_RequestedItems_LoginLogs0€?€?;IX_ExcludedDomains0€?€?)LoginLogs0€?€?5pk_dtproperties0€?€?;PK_ExcludedDomains0€?€?5PK_LastLoggedOn0€?€?9PK_RequestedItems0€?€?OQueryNotificationErrorsQueue0€?€?Gqueue_messages_6615773950€?€?Gqueue_messages_6935775090€?€?Gqueue_messages_7255776230€?€?3RequestedItems0€?€?;ServiceBrokerQueue0€?€?1sysallocunits0€?€?-sysasymkeys0€?€?+sysbinobjs0€?€?1sysbinsubobjs0€?€?'syscerts0€?€?+sysclsobjs0€?€?+syscolpars0€?€?/sysconvgroup0€?€?+sysdbfiles0€?€?'sysdercv0€?€?)sysdesend0€?€?)sysfiles10€?€?)sysftinds0€?€?-sysguidrefs0€?€?3syshobtcolumns0€?€?'syshobts0€?€?-sysidxstats0€?€?)sysiscols0€?€?€?)sysnsobjs0€?€?5sysobjkeycrypts0€?€?/sysobjvalues0€?€?)sysowners0€?€?'sysprivs0€?€?)sysqnames0€?€?3sysremsvcbinds0€?€?7sysrowsetcolumns0€?€?1sysrowsetrefs0€?€?+sysrowsets0€?€?#sysrts0€?€?3sysscalartypes0€?€?+sysschobjs0€?€?)sysserefs0€?€?7syssingleobjrefs0€?€?/syssqlguides0€?€?5systypedsubobjs0€?€?/sysxmitqueue0€?€?5sysxmlcomponent0€?€?-sysxmlfacet0€?€?5sysxmlplacement0€?€?)sysxprops0€?€?=VWCountItemsByLogin0€?€?-VWPer_Login0€?€?AVWRequestITEMS_Clientџ((йDF__dtpropert__versi__7A9C383Ct_checkinobjectdropuserobjectbyidgetpropertiesbyid_vcsvalidateloginparamsEventNotificationErrorsQueuePK_ExcludedDomainsRequestedItemssysclsobjsfiles1multiobjrefsremsvcbindsschobjsxmlfacet@Р@ -?Tgƒ•@ЃІ­ Г ПЪб0<"$YeОЊцqš]]€?>> ,0<AКB€@€?€@й8Of}”ЋТЂB€?@€?,§@@€?˜й@€?r’$€?€?Гоn'€?€?€?—o?+@€?ЪяГx0<" $e0Лцqš]]ЭЬЬ= @КB@"xPezЄЙЮуј @@€?D €?€?F @@€?IT№A€?P €@€?PK$B€?S @@€?SQ€@€?U €?€?UQ@@€?V џ(( D P KS U @Р…† 88рр‡`*<љe +бO%`€0<" $œe4Лцqš]]€?€?КB€?КB€?0<"  "0<" $Ў|DМцqš]]9Žc=€@КB€@.ЇОеь1H_vЄЛвщ$B€?€?€?@€? @€?Р@€?Р@€?Р@€? @€? @€? €?€? @@€? @@€? €?€? €@€?€?€?€?€?€?€?€?€?0<" "0<"$—эЬцqš]]9Žу= €@КB€@H_vЄЛвщР@€?@@€?@€?€?€?@@€? №A€? @@€?(B€?@@€? 0<"`"0<"@$Оeћyђqš]]?€@КB€@>'DB€?0B€?10fњш№їрjњ3@ы]]0п0kњИ#Hа#H8Р h/@`њЏЏЏЏ`oњ0YЕYЕ@[Е8lњН(QЕ`YЕ`QЕHYЕ d]T/р+HL  #Hp#H@#H#Hр"HА"H€"HP"H "H№!HР!H!H`!H0!H!Hа H  Hp H@ Hш7HИ7Hˆ7HX7H(7Hј6HШ6H˜6Hh6H86H6Hи5HЈ5Hx5HH5H5Hш4HИ4Hˆ4HX4H(4HшЧ!ИЧ!ˆЧ!XЧ!(Ч!јЦ!ШЦ!˜Ц!hЦ!8Ц!Ц!иХ!ЈХ!xХ!HХ!Х!шФ!ИФ!ˆФ!XФ!(Ф!шЯ!ИЯ!ˆЯ!XЯ!(Я!јЮ!ШЮ!˜Ю!hЮ!8Ю!Ю!иЭ!ЈЭ!xЭ!HЭ!Э!шЬ!ИЬ!ˆЬ!XЬ!(Ь!шл!Ил!ˆл!Xл!(л!јк!Шк!˜к!hк!8к!к!ий!Јй!xй!Hй!й!ши!Ии!ˆи!Xи!(и!ш'!И'!ˆ'!X'!('!ј&!Ш&!˜&!h&!8&!&!и%!Ј%!x%!H%!%!ш$!И$!ˆ$!X$!($!ш3!И3!ˆ3!X3!(3!ј2!Ш2!˜2!h2!82!2!и1!Ј1!x1!H1!1!ш0!И0!ˆ0!X0!(0!шCЕИCЕˆCЕXCЕ(CЕјBЕШBЕ˜BЕhBЕ8BЕBЕиAЕЈAЕxAЕHAЕAЕш@ЕИ@Еˆ@ЕX@Е(@ЕаOЕ OЕpOЕ@OЕOЕрNЕАNЕ€NЕPNЕ NЕ№MЕРMЕMЕ`MЕ0MЕMЕаLЕ LЕpLЕ@LЕLЕа[Е [Еp[Е@[Е[ЕрZЕАZЕ€ZЕPZЕ ZЕ№YЕРYЕYЕ 8дvњ@`њ pњ@kњ˜ƒ!y 0]Иoњ,@@W@РS@№?№?((V pњ ФbitјJ)Mpњˆpњ 0џџџџЈpњ@іїа4mњ0Шpњis_x8H^„vњЄvњДvњ”vњФvњH (`њ№њ@ Fwњ( Ф vњ 0 Э@ F0И)( №3рYЈ9љРwњШwњаwњиwњИљрwњиwњxrњlvo!ј(Иљo!Xn!3џџџџ0xња4o!Pxњ( №Z( №dxњ 03p{њp{њ( №ˆxњ 03˜xњ {њ {њ( №Ќxњ 03( №аxњ 03( №єxњ 03( №yњ 03( №€?€?b€?€?c€?€?h€?€?j€?€?l€?€?z€?€?€?€?Ѕ€?€?Ї€?€?­€?€?Џ€?€?Н€?€?ч€?€?я€?€?ё€?€?0<2$Ÿ†Њцqš€?&Д=&Д=0Ё­AиA€@_B[A€@иA€?0<) $ЌЛМцqš;;%I=@РD@,рѕ 4I^sˆВЧмё0EZo„™ЎУиэA€?џџlB€?B€?GC€?€@€?†B€?`A€? PA€? B€?€?€?@€?@@€? €@€?0pA€?2@€?8 A€?B€?€?U @€?d@€?њШA€?џРA€?РA€?ўA€?@€?€?€?t@€?а€@€?@@€?P0<) "0<)$\ЛъЪцqš;;ё№p=€?ТD€?мˆœАФиь(<PdxŒ ДШ@@€?"A€?#РA€?$LB€?0АA€?4?C€?8јA€?=@€?b€?€?h`A€?lB€?ЈA€?ЅxB€?Ї˜A€?­ИA€?ЏpB€?ч @€?я0<) "0<)$:ЛяЪцqš;;ЋЊ*>€@РD€@К0G^uŒЃиB€?ЄC€?€B€?tB€?р@€?@@€?0<1 @"0<1 @"0<1 @"0<)`"0<)@$ЎЛЛzђqš;;9Žc=€@РD€@.ЇОеь1H_vЄЛвщ@@€?"A€?#РA€?$LB€?0АA€?4?C€?8јA€?=@€?b€?€?h`A€?lB€?ЈA€?ЅxB€?Ї˜A€?­ИA€?Џ(B€?ч @€?яA€?0<,  "<oЈХ@РїШ%(`o@Рї@РїШ~oИ, Э@рLЕ№ ќкЮ Ќ Š h F _Уb "T`<‰[-бZ =0<@$ьeЊцqš€=€=€=жA€AЎA€?€@Ld€Ѓж@qžз7n‹ЎЯ /0€?€?#client0€?€?3db_accessadmin0€?€?9db_backupoperator0€?€?1db_datareader0€?€?1db_datawriter0€?€?-db_ddladmin0€?€?9db_denydatareader0€?€?9db_denydatawriter0€=€?'db_owner0€?€?7db_securityadmin0€?€?dbo0€?€?#eSpecs0€?€?!guest0€?€?;INFORMATION_SCHEMA0€?€?%PRIMARY0€?€?sysџ ((Tclientdb_backupoperatordatawriterdladminenydatawriterownerguestINFORMATION_SCHEMAsyq@РР Р ! (5:?Q0<@ $—еyђqš€?‰ˆˆ= €@€A€@H_vЄЛвщ@€?€?€?€?€?€?€?€?€?€?€?@€?€?€?@€?€?@€?@€?@€?€?€? @0<@ @$џкyђqš?@€A@:w%pA€?€?€?FGџ ((FG@‰0€@ЊB€@ ›7(?Vm„€?€?@B€?аA€?A€?@€?šШЂ‚@U@ч ™™Щ?€–@€–@pzђqšРT@ƒ ™™Щ?f @b @I„тЕ‰?0<$F }LGМбžUU€?СР@<22AЊBA жОЋЦсќ2MhƒžЙдя %@[v‘ЌЧт§3Ni„ŸКе№ &A\w’­Шуў4Oj… Л€?€?€?€?€?€?€?€?€?€? €?€?€?€?€?€?€?€?€?€?€?"€?€?)€?€?,€?€?.€?€?1€?€?€?3€?€?6€?€?7€?€?:€?€?<€?€?@€?€?A€?@€?E€?@€?I€?€?€?K€?€?L€?€?N€?€?Z€?€?€?\€?€?€?^€?€?€?`€?€?a€?ЈA€?a€?€?€?€?"€?€?.€?€?2€?€?C€?€?E€?€?_€?€?`€?€?"€?€?.€?€?€?€?€?€?€?€?€?€?€?€?ў €?€?€? €?€?€? €?€? ^ 4‹ž@U@щ2 ˆ?@ t@ t@гйЈm{о?ЖЅ"ž@U@ё2 ˆ?@рƒ@рƒ@гйЈm{о?–ШЂ‚@U@q 2 ˆ?@Ž@Ž@гйЈm{о?0< $Фї'ђЬžиžUUф8?/Ї<,,€@ЊB€@ T<`wŽЅМгъ/F]t‹ЂЙачў,CZqˆŸЖЭфћ)@Wn…œГЪсј&=€?€?€?€?€?€?€?€?€?€? €?€?€?€?€?€?@@€?€?€?€@€?"@€?)@€?,€@€>.€?€?1@@€?2@€?3@€?6€?€?7@€?:€?€?<@€?@€?€?A@@€?C€?€?D@@€?E€?@€?I@@@K€?€?L@€?N@€?Z@€?[€?€?\@€?]€?€?^@@@@@@`@€?a€?€?,§€?€?˜й@€?r’$@€?ьc(@@@а“3,@€?Bм.€?€?ЪяГxЖЅ"ž@U@', рх”? —@ —@›ШЂ‚@U@ч, рх”?€–@€–@pzђqšРT@ƒ+`UU•?f @b @Ч<ѓ€@ЊB€@ ›ƒ(?Vm„€?€?@B€?аA€?A€?@€?ЛЅ"ž@U@' ™™Щ? —@ —@›ШЂ‚@U@ч ™™Щ?€–@€–@pzђqšРT@ƒ ™™Щ?f @b @I„тЕ‰?џџа4шЩШО @ЩќЩ8yЯЈž (ЩˆЩиk @@ЭШО xЩМЩјЩPЃкЁн— IH<q I/o‰€0<6$ФhПт0ЩžžžЋЊЊ>€?C€? T<,@”B€?@B€?B€?•ч0ŸžРc@p`UUе?€o@€o@Тр0gžРc@x`UUе?€o@€o@ур0=žРc@€`UUе?€o@€o@0<7 @$bЛиР’"ž?€B€C€@ >к'ЌB€?IC€?WЩЂ‚№q@ћ р?€‘@€‘@{ђqšрo@р?ќ™@|™@WЪJлН|У?0<6 @$b:€Ѕ"žžž?€@C€@ >к'’B€?ЊB€?1ЩЂ‚Рc@К р?Ž@Ž@хzђqš@_@­р?\–@и•@˜Rњ˜!а?0<7$ФыЏžиž з#>ЋЊЊ< Жа;3Yd;,,@A€C€@€@€@ T<`wŽЅМгъ/F]t‹ЂЙачў,CZqˆŸЖЭфћ)@Wn…œГЪсј&=@€?@@€?@@€?@€? €?€?€?€?@@€? @€?@A€?`A€?"pA€?)р@€?, @€?.р@€?1Р@Р@Р@3A€?6A€?7A€?:A€?<Р@€?@€@€?A€@€?C@@€?D @€?E€?€?G€?€?H@€?I0A€?J A€?KР@€?L @€?N€@€?Zр@€?[@€?\ @€?]@@B@@@_Р@Р@Р@aр@€?,§ЈA€?˜й@€?r’$ A€?ьc( A A Aа“3,€@€?Bм. @€?ЪяГxгР’"ž№q@Л,`UU•?`’@`’@WЩЂ‚№q@ћ ,`UU•?€‘@€‘@sЊцqšl@ў, ˆЩ•?xš@|™@gвюDѕй?0<7 @$AыЏžиž%I?6”W=€@€C€@ бЙxІНды0G^uŒЃКдB€? B€?ИA€?A‚?@@@@@@@@@ A€? `A€?  A€? р@€?€@€?@€?€?€?€?€?€?иР’"ž№q@ЛР†ђЊ?`’@`’@WЩЂ‚№q@ћ Р†ђЊ?€‘@€‘@{ђqšРo@ А?@š@|™@›GVm–.Ы?0<7 @$ЎыЏžиž?€@€C€@ >&'ЌB€?IC€?иР’"ž№q@Лр?`’@`’@WЩЂ‚№q@ћ р?€‘@€‘@{ђqšрo@р?ќ™@|™@WЪJлН|У?0<6 @$Ў*Эžиžžž?€@C€@ >&'’B€?ЊB€?€Ѕ"žРc@:р?€@€@1ЩЂ‚Рc@К р?Ž@Ž@хzђqš@_@­р?\–@и•@˜Rњ˜!а?р@€?, @€?.р@€?1Р@Р@Р@3A€?6A€?7A€?:A‚?<Р@€?@€@€?A€@€?C@@€?D @€?E€?€?G€?€?H@€?I0A€?J A€?KР@€?L @€?N€@€?Zр@€?[@€?\ @€?]@@@@@@_Р@Р@Р@aр@€?,§ЈA€?˜й@€?r’$ A€?ьc( A A Aа“3,€@€?Bм. @€?ЪяГxгР’"ž№q@Л,`UU•?`’@`’@WЩЂ‚№q@ћ ,`UU•?€‘@€‘@sЊцqšl@ў, ˆЩ•?xš@|™@gвюDѕй?^uŒЃКдB€? B€?ИA€?A€?@@@@@@@@@ A€? `A€?  A€? р@€?€@€?@€?€?€?€?€?€?WЩЂ‚№q@ћ Р†ђЊ?€‘@€‘@{ђqšРo@ А?@š@|™@›GVm–.Ы?ˆОюиk @ ЗШО xПюМПюјВюЬб PУИсBЈЙх ъ„эЌш`›џJ˜йJ00зыaBT0фHGNƒ hFj€EjbzEjˆEjFjpEjO1фPhase I Environmental Site Assessment-Second Edition; Update No 1T1фA08EПE hFПbpEП€EПˆEПFПpEПpEПќ2фSeries 1 freight containers Specification and testing Part 1: General cargo containers for general purposes-Fifth Edition; Amendment 1: 03/01/93; Amendment 2: 07/01/98; Amendment 3: 06/15/05; Amendment 5: 05/15/06; Amendment 4: 11/01/06T2фю08EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3T3ф<Lighting Industrial Facilities-Errata - 2001; Errata 7/20/04Ž4фNATO Materiel Configuration Management Policy and Procedures for Multinational Joint Projects-ED 2 AMD 1 Amendment 1: 03/18/1992T4ф€08EзE hFзbpEз€EзˆEзFзpEз~5фSoftware engineering"- Guidelines for the application of ISO 9001:2000 to computer software (ISO/IEC 90003:2004)T5фp08EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧT6ф Safety ColorsЩ7фASD Manual V.#1: Manual of Steel Construction Allowable Stress Design V.#2: Manual of Steel Construction Connections-See AISC M016 for Volume 1 and AISC M017 for Volume 2; Bib Record onlyT7фЛ0 8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3Щ8фASD Manual V.#1: Manual of Steel Construction Allowable Stress Design V.#2: Manual of Steel Construction Connections-See AISC M016 for Volume 1 and AISC M017 for Volume 2; Bib Record onlyT8фЛ0 8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3`9фInformation and Documentation - Records Management - Part 1: General-First EditionT9фR08ErE hFrbpEr€ErˆErFrpErc:фJnformation and Documentation - Records Management - Part 2: Guidelines-First EditionT:фU08EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯV;фNAS Certification & Qualification of Nondestructive Test Personnel-REV 3T;фH08EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯZщыStandard Specification for Polyethylene Plastics Pipe and Fittings MaterialsTщыL08EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧ`EЧZЙѓStandard Specification for Polyethylene Plastics Pipe and Fittings MaterialsTЙѓL08EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3`EN3КѓSterilization of health care products Radiation Part 1: Requirements for development, validation and routine control of a sterilization process for medical devices-First Edition; Together with ISO 11137-2 and ISO 11137-3 supersedes ISO 11137:1995TКѓј08EjE hFjbpEj€EjˆEjFjpEjОЛѓSterilization of health care products Radiation Part 2: Establishing the sterilization dose-First Edition; Together with ISO 11137-1 and ISO 11137-3 supersedes ISO 11137:1995TЛѓА08EjE hFjbpEj€EjˆEjFjpEjpEjЙМѓSterilization of health care products Radiation Part 3: Guidance on dosimetric aspects-First Edition; Together with ISO 11137-1 and ISO 11137-2 supersedes ISO 11137:1995TМѓЋ08EN3E jFN3bpEN3€EN3ˆEN3FN3pEN3pEN3‰НѓEarth-moving machinery - Falling-object protective structures - Laboratory tests and performance requirements-Fifth EditionTНѓ{08EяE hFяbpEя€EяˆEяFяpEя”ОѓEarth-Moving Machinery - Laboratory Evaluations of Protective Structures - Specifications for Deflection-Limiting Volume Fifth EditionTОѓ†0!8EjE hFjbpEj€EjˆEjFjpEjpEjTПѓQualivy Management Systems - Fundamentals and Vocabulary-Third EditionTПѓF0#8EїE hFїbpEї€EїˆEїFїpEїfРѓGuidelines for Quality and/or Environmental Management Systems Auditing-Premiшre щditionTРѓX0%8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧTСѓ7Quality Management Systems - Requirements-Third Edition•ТѓThe ISO 15189:2003 essentials A practical handbook for implementing the ISO 15289:2003 Standard for medical laboratories-First EditionTТѓ‡0(8EjE hFjbpEj€EjˆEjFjpEj•УѓThe ISO 15189:2003 essentials A practical handbook for implementing the ISO 15189:2003 Standard for medical laboratories-First EditionTУѓ‡0*8EчE hFчbpEч€EчˆEчFчpEч•ФѓThe ISO 15189:2003 essentials A practical handbook for implementing the ISO 15189:2003 Standard for medical laboratories-Firrt EditionTФѓ‡0,8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3hХѓMedical laboratories - Particular requirements for quality and competence (ISO 15189:2007)TХѓZ0.8EчE hFчbpEч€EчˆEчFчpEчpEчTЦѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11TЧѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11TШѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGENENT-Edition 11TЩѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11TЪѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11TЫѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11TЬѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11TЭѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11TЮѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edivion 11TЯѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11Tаѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11Tбѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11Tвѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11Tгѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11Tдѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11]еѓMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TеѓO0?8EПE hFПbpEП€EПˆEПFПpEПpEПTжѓInspection Material, PenetrantALITY MANAGEMENT-Edition 11Tзѓ(Structural Design of Glass for BuildingsиѓStrength design in aluminum/ Commentary on CSA S157-05, Strength design in aluminum-Fourth Edition; Incorporates Update No. 1-2Tиѓ0C8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3\йѓRubber, Vulcanized and Thermoplastic - Resistance to Weathering-Second EditionTйѓN0E8EчE hFчbpEч€EчˆEчFчpEч…кѓPiston-Operated Volumetric Apparatus - Part 1: Terminology, General Requirements and User Recommendations-First EditionTкѓw0G8EjE hFjbpEj€EjˆEjFjpEjлѓZлѓPiston-Operated Volumetric Bpparatus - Part 2: Piston Pipettes-First EditionEчˆEчFчpEчкѓ…кѓPiston-Operated Volumetric Apparatus - Part 1: Terminology, General Requirements and User Recommendations-First EditionTкѓw0G8EjE hFjbpEj€EjˆEjFjpEjPпlXпl0‚ЦиŠЦЄЦ шЩ РŽрРОnЇжtя›?ы^ ЖbБ] Еa ЙeНiСmХ] t ‹7ЂNњ”@ь˜А'г  Ц  Д Ў Z Ќ R ўЈTё=щ ЬЏ[н‰ћЇSWД`џF˜й‰ы1йf";TлѓL0Iƒ hFј€EјbzEјˆEјFјpEјwмѓClinical Investigation of Medical Devices for Human Subjects - Part 1: General Requirements-First EditionTмѓi18EзE hFзbpEз€EзˆEзFзpEзTнѓNon-Carpet Floor CoveringlоѓGeneral requirements for the competence of testing and calibration laboratories-Second editionTоѓ^18EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯTпѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11lрѓGeneral requirements for the competence of testing and calibration laboratories-Second editionTрѓ^18EПE hFПbpEП€EПˆEПFПpEПƒсѓCorrigendum AC - Medical devices - Quality management systems - Requiremenvs for regulatory purposes (ISO 13485:2003)Tсѓu1 8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3тѓMedical devices Quality management systems Guidance on the application of ISO 13485:2003-First Edition; Replaces ISO 14969:1999Tтѓ1 8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3nуѓMedical devices Quality management systems Requirements for regulatory purposes-Second EditionTуѓ`1 8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3Tфѓ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11Tхѓ@Project 25 Digital Land Mobile Radio – Link Layer Authentication|цѓPOLYETHYLENE, HIGH DENSITY BLOW MOLDING COMPOUND, GASOLINE RESISTANT ***TO BE USED WITH FORD WSS-M99P1111-A***Tцѓn18EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯ{чѓLIVE WORKING – PORTABLE EQUIPMENT FOR GROUNDING AND BONDING-Amendment No. 1: March, 2020; IEC 61230:1993, MODTчѓm18Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3 шѓPaints and Varnishes - Determination of "Soluble" Metal Content - Part 1: Determination of Lead Content - Flame Atomic Absorption Spectrometric Method and Dithizone Spectrophotometric Method Third Edition; (AS/NZS 1580.501.1:1994) 1994) (PNS 530: 1991)Tшѓќ18EчE hFчbpEч€EчˆEчFчpEч щѓPaints and Varnishes - Determination of "Roluble" Metal Content - Part 1: Determination of Lead Content - Flame Atomic Absorption Spectrometric Method and Dithizone Spectrophotometric Method Third Edition; (AS/NZS 1580.501.1:1994) 1994) (PNS 530: 1991)Tщѓќ18EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯpEЯ ъѓPaints and Varnishes - Determination of "Soluble" Metal Content - Part 1: Determination of Lead Content - Flame Atomic Absorption Spectrometric Method and Dithizone Spectrophotometric Method Third Edition; (AS/NZS 1580.501.1:1994) 1994) (PNS 530: 1991)Tъѓќ18EчE hFчbpEч€EчˆEчFчpEчpEчсыѓPaints and Varnishes - Determination of "Soluble" Metal Content - Part 2: Determination of Antimony Content - Flame Atomic Absorption Spectrometric Method and Rhodamine B Spectrophotometric Method Second EditionTыѓг18Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3ГьѓPaints and Varnishes - Determination of "Soluble" Metal Bontent - Part 3: Determination of Barium Content - Flame Atomic Emission Spectrometric Method Second EditionTьѓЅ18EчE hFчbpEч€EчˆEчFчpEчpEчoэѓFood safety management systems Requirements for any organization in the food chain-First EditionTэѓa18Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3КюѓRecommended Practice for the Classification of Combustible Dusts and of Hazardous (Classified) Locations for Enectrical Installations in Chemical Process Areas-2008 EditionTюѓЌ1!8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3UяѓControl of Electrochemical Corrosion of Underground Metallic StructuresTяѓG1#8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3‘№ѓPetroleum and natural gas industries — Offshore production installations — Heating, ventilation and air-conditioning-Second EditionT№ѓƒ1%8Ef3E hFf3brEf3€Ef3ˆEf3Ff3pEf3‹ёѓShipbuilding - Engine-Room Ventilation in Diesel-Engined Ships - Design Requirements and Basis of Calculations-Second EditionTёѓ}1'8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯ{ђѓGuidance for ANSI/AAMI/ISO 11607, Packaging for terminally sterilized medical devices— Part 1 and Part 2:2006Tђѓm1)8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3VѓѓStandard Guide for Writing a Specifibation for Sterilizable Peel PouchesTѓѓH1+8EпE hFпbpEп€EпˆEпFпpEпVєѓNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TєѓH1-8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3Tѕѓ7Quality Management Systems - Requirements-Third EditionaіѓPoint-of-care testing (POCT) Requirements for quality and competence-First EditionTіѓS108EjE hFjbpEj€EjˆEjFjpEjTїѓ;Medical laboratories Requirements for safety-First EditionlјѓGeneral requirements for the competence of testing and calibration laboratories-Second editionTјѓ^138EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯpEЯlљѓGeneral requirements for the competence of testing and calibration laboratories-Second editionTљѓ^158EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯpEЯlњѓGeneral requirements for the competence of testing and calibration laboratories-Second editionTњѓ^178EпE hFпbpEп€EпˆEпFпpEпmћѓSafety of machinery – Electrical equipment of machines – Part 1: General requirements-Edition 5Tћѓ_198EпE hFпbpEп€EпˆEпFпpEпpEпXќѓGeographic Information - Spatial Referencing by Coordinates-Second EditionTќѓJ1;8EпF hFпbpEп€EпˆEпFпpEпpEпT§ѓ9Part 3: Temperature Measurement Instruments and ApparatusVўѓNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TўѓH1>8EзE hFзbpEз€EзˆEзFзpEзџѓData Elements and Interchange Formats - Information Interchange - Representation of Dates and Times-Third EditionTџѓq1@8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3‹єBasic Principles for Graphical Symbols for Use on Equipment - Part 2: Form and Use of Arrows-First Edition; Replaces ISO 4196Tє}1B8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3pEЫ3МєBasic principles for graphical symbols for use on equipment - Part 4: Guidelines for the adaptation of graphical symbols for use on screens and displays (icons)-First EditionTєЎ1D8EзE hFзbpEз€EзˆEзFзpEзpEзart 2: Form and Usf of Arrows-First Edition; Replaces ISO 4196Tє}1B8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3pEЫ3єМєBasic principles for graphical symbols for use on equipment - Part 4: Guidelines for the adaptation of graphical symbols for use on screens and displays (icons)-First Edition €˜( Ў—л‡ќЈ)е+з+ОjўЊ>ъ~*жu!Эw#ЭyўЊЫ:ц‘=ƒ/РlЙ e „ 0 & в Ш t j›GЫw#Яa ~*ЇSч“?г+Д`џF˜йь–2лyТЎєBasic principles for graphical symbols for use on equipment - Part 1: Creation of symbol originals-First Edition; Replaces ISO 3461-1(1988) and IEC 60416 (1988)Tє 28Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3•єBasic principles for graphical symbols for use on equipment Part 3: Guidelines for the application of graphical symbols-First EditionTє‡28EзE hFзbpEз€EзˆEзFзpEзpEзyєStandard Practice for Classification of Soils for Engineering Purposes (Unified Soil Classification System)Tєk28EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3ˆєPlastics - Determination of Tensile Properties - Part 2: Test Conditions for Moulding and Extrusion Plastics-First EditionTєz28Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3tєResin Based Reactive Compounds Used for Electrical Insulation - Part 2: Methods of Test-Second EditionTєf28Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3pEф3|єElectrical Strength of Insulating Materials - Test Methods - Part 1: Tests at Power Frequencies-Second EditionTєn2 8EзE hFзbpEз€EзˆEзFзpEзpEзPєPlastics - Determination of Tensile-Impact Strength-Second EditionTєB2 8EзE hFзbpEз€EзˆEзFзpEзpEзe єPlastics - Determination of Flexural Properties-Fourth Edition; Amendment 1: 02/15/2004T єW28Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3‰ єResin Based Reactive Compounds Used for Electrical Insulation - Part 1: Definitions and General Requirements-Second EditionT є{28EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3pEЫ3‰ єResin Based Reactive Compounds Used for Elebtrical Insulation - Part 1: Definitions and General Requirements-Second EditionT є{28EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3Й єEvaluation and Qualification of Electrical Insulation Systems-Third Edition; Supersedes IEC 60791:1984, IEC 60792-1:1985, IEC 60941:1988, IEC 61356:1995 and IEC 61359:1995T єЋ28EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3pEЫ3Х єTest Methods for the Determination of Bond Strength of Impregnating Agents to an Enamelled Wire Substrate-Edition 1; Replaces IEC 60290: 1969 and IEC 60699: 1981; Amendment 1: 04/2006T єЗ28EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3‡єTest Procedure for the Determination of the Temperature Index of Enamelled Winding Wires-Third Edition; Amendment 1- 1997Tєy28EзE hFзbpEз€EзˆEзFзpEзpEзlєEngineering Design in Wood-Eighth Edition; Update No 1; Supplement 1-2005; Rerrinted June 2005Tє^28EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3~єMedical devices — Application of risk management to medical devices-Second edition; Corrected Version 10/01/2007Tєp28E4E hF4bpE4€E4ˆE4F4pE4nєMedical devices Quality management systems Requirements for regulatory purposes-Second EditionTє`28Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3‚іMedical electrical equipment – Part 1: General requirements for basic safety and essential performance-Third EditionTєt2 8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3Tє7Quality Management Systems - Requirements-Third EditionaєEnvironmental management systems Requirements with guidance for use-Second EditionTєS2#8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3iєPlastics - Liquid Resins -"Determination of Density by the Pyknometer Method-Second EditionTє[2%8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3пєPlastics Methods for determining the density of non-cellular plastics Part 1: Immersion method, liquid pyknometer method and titration method-First Edition; Together with 1183-2 and 1183-3 replaces 1183:1987Tєб2'8Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3жєGuidelines for Quality and/or Environmentan Management Systems Auditing-First Edition; Replaces ISO 10011-1:1990, ISO 10011-2:1991, ISO 10011-3:1991, ISO 14010:1996, ISO 14011:1996, and ISO 14012:1996TєШ2)8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3єMedical devices Quality management systems Requirements for regulatory purposes-Second Edition; ISO 13485: 1996Tєq2+8E4E hF4bpE4€E4ˆE4F4pE4ŒєEnergy performance and capacity of household refrigerators, refrigerator-freezers, freezers, and wine chillers-Seventh EditionTє~2-8EjE hFjbpEj€EjˆEjFjpEjTєPersonal Body ArmourTєPersonal Body ArmourTєPersonal Body ArmourъєPower Lawn-Mowers, Lawn Tractors, Lawn and Garden Tractors, Professional Mowers, bnd Lawn and Garden Tractors with Mowing Attachments - Definitions, Safety Requirements and Test Procedures-First Edition; Amendment 1-1992Tєм228E\3E hF\3bpE\3€E\3ˆE\3F\3pE\3lєGeneral requirements for the competence of testing and calibration laboratories-Second editionTє^248EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3„єGeneral requirements for the competence of testing and calibration laboratories TECJNICAL CORRIGENDUM 1-Second editionTєv268E\3E hF\3bpE\3€E\3ˆE\3F\3pE\3pE\3Y єSecurity Guards and Security Guard Supervisors-Supersedes CAN/CGSB-133.2-92T єK288E4E hF4bpE4€E4ˆE4F4pE4І!єMethod for the determination of ink cartridge yield for colour inkjet printers and multi-function devices that contain printer components-Second EditionT!є˜2:8E 4E hF 4bpE"4€E 4ˆE 4F 4pE 4T"є1Dimensional Tolerances for Aluminum Mill ProductsY#єSecurity Guards and Security Guard Supervisors-Supersedes CAN/CGSB-133.2-92T#єK2=8EjE hFjbpEj€EjˆEjFjpEjpEjy$єGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005T$єk2?8E\3E hF\3bpE\3€E\3ˆE\3F\3pE\3pE\3a‰ћEnvironmental management systems Requirements with guidance for use-Second EditionT‰ћS2A8E4E hF4bpE4€E4ˆE4F4pE4`E4ЪŠћElectromagnetic compatibility (EMC) – Part 4-6: Testing and measurement techniques – Immunity to conducted disturbances, induced by radio-frequency fields-Edition 2.2; Consolidated ReprintTŠћМ2C8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3‹ћЪ‹ћElectromagnetic compatibility (EMC) –"Part 4-6: Testing and measurement techniques – Immunity to conducted disturbances, induced by radio-frequency fields-Edition 2.2; Consolidated Reprintand measurement techniques – Immunity to conducted disturbances, induced by radio-frequency fields-Edition 2.2; Consolidated ReprintЬj Lы—ЪqЩ#Яv"žJоŠ LјЄPФpёЧs”@зƒ"Юzј Є 6 т d  Є P Щ u А \ ЃOЦrщ•0мŒ8Мhє ФKїb`џF˜йG;3н‘‚0T‹ћМ2Eƒ hF\3€E\3bzE\3ˆE\3F\3pE\3ŒћLignes directrices pour lДaudit des systшmes de management de la qualitщ et/ou de management environnemental-Premiere Edition; Remplace CAN/CSA-ISO 10011-1-94, CAN/CSA-ISO 10011-2-94, CAN/CSA-ISO 10011-3-94, CAN/CSA-ISO 14010-96, CAN/CSA-ISO 14011-96, CAN/CSA-ISO 14012-96TŒћ38Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3іћGuidelines for quality and/or environmental management systems auditing-First Edition; Replaces CAN/CSA-ISO 10011-1-94, CAN/CSA-ISO 10011-2-94, CAN/CSA-ISO 10011-3-94, CAN/CSA-ISO 14010-96, CAN/CSA-ISO 14011-96, CAN/CSA-ISO 14012-96Tћш38EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3<TŽћ7Quality Management Systems - Requirements-Third EditionTћ7Quality Management Systems - Requiremenvs-Third EditionY Tћ7Quality Management Systems - Requirements-Third EditionY T‘ћ)Quality Management Systems - Requirements-Third Editiona’ћEnvironmental management systems Requirements with guidance for use-Second EditionT’ћS3 8EЯ3E hFЯ3bpEЯ3€EЯ3ˆEЯ3FЯ3pEЯ3l“ћGeneral requirements for the competence of testing and calibration laboratories-Second editionT“ћ^3 8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3l”ћGeneral requirements for the competence of testing and calibration laboratories-Second editionT”ћ^3 8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3pEА3l•ћGeneral requirements for the competence of testing and calibration laboratories, (May 5, 2000)T•ћ^38E)4E hF)4bpE)4€E)4ˆE)4F)4pE)4l–ћGeneral requirements for the competence of testing and calibration laboratories-Second editionT–ћ^38EЯ3E hFЯ3bpEЯ3€EЯ3ˆEЯ3FЯ3pEЯ3pEЯ3~—ћInformation technology Security techniques Code of practice for information security management-Second EditionT—ћp38EЯ3E hFЯ3bpEЯ3€EЯ3ˆEЯ3FЯ3pEЯ3pEЯ3l˜ћGeneral requirements for the competence of testing and calibration laboratories-Second editionT˜ћ^38En3E hFn3bpEn3€En3ˆEn3Fn3pEn3Љ™ћIdentification Markings for Dedicated Aviation Fuel Manufacturing and Distribution Facilities, Airport Storage and Mobile Fueling Equipment-Seventh EditionT™ћ›38Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3lšћCardiovascular Implants - Endovascular Devices - Part 1: Endovascular Prostheses-First EditionTšћ^38Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3pEv3y›ћSpecification for Quality Programs for the Pevroleum, Petrochemical and Natural Gas Industry-Eighth EditionT›ћk38Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3pEv3ЏœћStandard Specification for Alloy-Steel and Stainless Steel Bolting Materials for High Temperature or High Pressure Service and Other Special Purpose ApplicationsTœћЁ38EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3Tћ2Standard Specification for Headgear Used in Soccer`{@ЅžћStandard Rpecification for Carbon and Alloy Steel Compressible-Washer-Type Direct Tension Indicators for Use with Cap Screws, Bolts, Anchors, and StudsTžћ—3 8En3E hFn3bpEn3€En3ˆEn3Fn3pEn3pEn3TŸћ1Dimensional Tolerances for Aluminum Mill ProductsT ћ1Dimensional Tolerances for Aluminum Mill ProductslЁћGeneral requirements for the competence of testing and calibration laboratories-Second editionTЁћ^3$8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3TЂћ8Standard Reference Radiographs for Ductile Iron CastingsTЃћ+Standard Guide for Radiographic ExaminationЊЄћReciprocating internal combustion engines — Exhaust emission measurement — Part 4: Steady-state test cycles for different engine applications-Second EditionTЄћœ3(8En3E hFn3bpEn3€En3ˆEn3Fn3pEn3ЏЅћRebiprocating internal combustion engines Exhaust emission measurement Part 1: Test-bed measurement of gaseous and particulate exhaust emissions-Second EditionTЅћЁ3*8Eі3E hFі3bpEі3€Eі3ˆEі3Fі3pEі3pEі3TІћ+Standard Guide for Radiographic ExaminationiЇћStandard Reference Radiographs for Gray Iron Castings up to 4 1/2 in. (114 mm) in ThicknessTЇћ[3-8En3E hFn3bpEn3€En3ˆEn3Fn3pEn3pEn3ƒЈћProtection Against Corrosion of Iron and Steel in Structures - Zinc and Aluminium Coatings - Guidelines-First EditionTЈћu3/8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3ЉћHot Dip Galvanized Coatings on Fabricated Iron and Steel Articles - Specifications and Test Method-Second EditionTЉћq318Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3pEv3ŠЊћStandard Specification for Rigid Poly(Vinyl Chloride) (PVC) Exterior.Profile Extrusions Used for Assembled Windows and DoorsTЊћ|338E)4E hF)4bpE)4€E)4ˆE)4F)4pE)4oЋћStandard Test Methods for Impact Resistance of Rigid Poly(Vinyl Chloride) (PVC) Building ProductsTЋћa358Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3ЌћHot Dip Galvanized Coatings on Fabricated Iron and Steel Articles - Specifications and Test Method-Second EditionTЌћq378Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3pEф3v­ћConformity Assessment - General Requirements for Bodies Operating Certification of Persons-First EditionT­ћh398En3E hFn3bpEn3€En3ˆEn3Fn3pEn3ИЎћSpecification and qualification of welding procedures for metallic materials Qualification based on pre-production welding test-First Edition; Supersedes ISO 9956-8:1995TЎћЊ3;8E)4E hF)4bpE)4€E)4ˆE)4F)4pE)4pE)4ИЏћSpecification and qualification of welding procedures for metallic materials Qualification based on pre-production welding test-First Edition; Supersedes ISO 9956-8:1995TЏћЊ3=8E)4E hF)4bpE)4€E)4ˆE)4F)4pE)4pE)4ИАћSpecification and qualification of welding procedures for metallic materials Qualification based on pre-production welding test-First Edition; Supersedes ISO 9956-8:1995TАћЊ3?8Eі3E hFі3bpEі3€Eі3ˆEі3Fі3pEі3 БћSpecification and Qualification of Welding Procedures for Metallic Materials - Welding Procedure Specification - Part 2: Gas Welding-First EditionTБћ’3A8Eі3E hFі3bpEі3€Eі3ˆEі3Fі3pEі3pEі3lВћGeneral requirements for the competence of testing and calibration laboratories-Second editionTВћ^3C8E)4E hF)4bpE)4€E)4ˆE)4F)4pE)4pE)4ГћjГћCode d’installation du gaz naturfl et du propane-Treizieme Edition; Supplщment nК 1: 01/2007Бћ’3A8Eі3E hFі3bpEі3€Eі3ˆEі3Fі3pEі3pEі3ВћlВћGeneral requirements for the competence of testing and calibration laboratories-Second editionTВћ^3C8E)4E hF)4bpE)4€E)4ˆE)4F)4pE)4pE)4 d?и =и 0) 7и бoЏЛЏїЃы—!ЭNњ‹7­Yк†ЏFђžя›ёIѕ‰5сш ” @ ‘ = Ф p  А  Г G ѓu!ЕaѕЁ5сu!РlФp&вД`џI˜й=?4оНCTГћ\3Eƒ hF@4€E@4bzE@4ˆE@4F@4pE@4jДћCode d’installation du gaz naturel et du propane-Treizieme Edition; Supplщment nК 1: 01/2007TДћ\48EКLE hFКLbpEКL€EКLˆEКLFКLpEКLШЕћMedical Electrical Equipment - Part 1-1: General Requirements for Safety - Collateral Standard: Safety Requirements for Medical Electrical Systems-Second Edition; CEI/IEC 60601-1-1: 2000TЕћК48Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3аЖћMedical electrical equipment – Part 1-2: General requirements for basic safety and essential performance – Collateral standard: Electromagnetic compatibility – Requirements and tests-Edition 3.0TЖћТ48Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3pEv3МЗћMedical electrical equipment - Part 2-27: Particular requiremenvs for the safety, including essential performance, of electrocardiographic monitoring equipment-Second EditionTЗћЎ48E)4E hF)4bpE)4€E)4ˆE)4F)4pE)4ъИћMedical Electrical Equipment – Part 2-30: Particular Requirements for the Safety, Including Essential Performance, of Automatic Cycling Non-Invasive Blood Pressure Monitoring Equipment-Second Edition; IEC 60601-2-30:1999TИћм4 8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3pEv3šЙћMedical electrical equipment - Part 2-49: Particular requirements for the safety of multifunction patient monitoring equipment-First EditionTЙћŒ4 8E)4E hF)4bpE)4€E)4ˆE)4F)4pE)4pE)4TКћ9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11‘ЛћPetroleum and natural gas industries — Offshore production installations — Heating, ventilation and air-conditioning-Second EditionTЛћƒ48EА3E jFА3bpEА3€EА3ˆEА3FА3pEА3‹МћShipbuilding - Engine-Room Ventilation in Diesel-Engined Ships - Design Requirements and Basis of Calculations-Second EditionTМћ}48EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3pEА3{НћCleanrooms and associated controlled environments Part 1: Classification of air cleanliness-Premiшre щditionTНћm48E)4E hF)4bpE)4€E)4ˆE)4F)4pE)4TОћ:Recommended Practice fnr Quality Control of Image Scanners~ПћMedical devices — Application of risk management to medical devices-Second edition; Corrected Version 10/01/2007TПћp48Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3cРћInformation and Documentation - Records Management - Part 2: Guidelines-First EditionTРћU48EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3TСћ9Standard Test Methods for Measuring Adhesion by Tape Test‹ТћElectronic Imaging - Test Target for the Black-and-White Scanning of Office Documents - Part 1: Characteristics-First EditionTТћ}48Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3ЋУћElectronic Imaging - Test Target for the Black-and-White Scanning of Office Documents - Part 2: Method of Use-First Edition; Technical Corrigendum 1 3/1/2002TУћ48E@4E hF@4bpE@4€E@4ˆE@4F@4pE@4VФћNAS Certificavion & Qualification of Nondestructive Test Personnel-REV 3TФћH48EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3ХћWelded, Brazed and Soldered Joints - Symbolic Representation on Drawings-Third Edition; Includes Draft Addendum 1TХћq4 8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3eЦћStandard Specification for Polyethylene Plastics Extrusion Materials for Wire and CableTЦћW4"8E@4E hF@4bpE@4€F@4ˆE@4F@4pE@4eЧћStandard Specification for Polyethylene Plastics Extrusion Materials for Wire and CableTЧћW4$8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3sШћStandard for Thermal Insulation - Spray Applied Rigid Polyurethane Foam, Medium Density - ApplicationTШћe4&8E@4E hF@4bpE@4€E@4ˆE@4F@4pE@4pE@4vЩћCanadian Keyboard Standard for the English and French Languages-Second Edition; General"Instruction No 1TЩћh4(8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3vЪћCanadian Keyboard Standard for the English and French Languages-Second Edition; General Instruction No 1TЪћh4*8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3pEv3sЫћStandard for Thermal Insulation - Spray Applied Rigid Polyurethane Foam, Medium Density - ApplicationTЫћe4,8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3pEv3vЬћCanadian Keyboard Standard for the English and French Languages-Second Edition; General Instruction No 1TЬћh4.8E)4E hF)4bpE)4€E)4ˆE)4F)4pE)4vЭћCanadian Keyboard Standard for the English and French Languages-Second Edition; General Instruction No 1TЭћh408Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3pEv3VЮћNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TЮћH428EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3VЯћNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TЯћH448EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3VаћNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TаћH468EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3pEА3VбћNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TбћH4:8EХ3E hFХ3bpEХ3€EХ3ˆEХ3FХ3pEХ3VвћErgonomics Manual handling Part 1: Lifting and carrying-Premiшre щditionTвћH4:8EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3pEЭ3YгћErgonomics — Manual handling — Part 2: Pushing and pulling-Premiшre щditionTгћK4<8EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3pEЭ3nдћCosmetics — Microbiology — Detection of specified and non-specified microorganisms-First EditionTдћ`4>8EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3pEЭ3nећCosmetics — Microbiology — Detection of specified and non-specified microorganisms-First EditionTећ`4@8EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3pEЭ3mжћCosmetics Microbiology Enumeration and detection of aerobic mesophilic bacteria-First EditionTжћ_4B8EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3pEЭ3ЙзћIndustrial Automation Systems and Invegration - Product Data Representation and Exchange - Part 104: Integrated Application Resource: Finite Element Analysis-First EditionTзћЋ4D8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3ЂићIndustrial Automation Systems and Integration - Product Data Representation and Exchange - Part 1: Overview and Fundamental Principles First EditionTић”4F8Eі3E hFі3bpEі3€Eі3ˆEі3Fі3pEі3йћaйћEnvironmental managfment systems Requirements with guidance for use-Second Editionlysis-First EditionTзћЋ4D8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3ићЂићIndustrial Automation Systems and Integration - Product Data Representation and Exchange - Part 1: Overview and Fundamental Principles First Editionџџ0о|к†Эy ИJіˆ4л‡1н‡3н‰3п‰5ПkѕЁ.кdšFгЦa Ž:ф  х ‘  В ^ ћ Ї ) е   В'гBюšЌТnВ^Ž:rД`џK˜йL,5с8A€ь:TйћS4Hƒ hFА3€EА3bzEА3ˆEА3FА3pEА3pEА3[кћStandard Test Methods for Specific Gravity of Soil Solids by Water PycnometerTкћM58Eі3E hFі3bpEі3€Eі3ˆEі3Fі3pEі3`лћStandard Method for Measurement of Stain Resistance of Anodic Coatings on AluminumTлћR58Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3SмћStandard Test Method for Sieve Analysis of Fine and Coarse AggregatesTмћE58EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3SнћStandard Test Method for Sieve Analysis of Fine and Coarse AggregatesTнћE58Eі3E hFі3bpEі3€Eі3ˆEі3Fі3pEі3pEі3€оћInformation technology Database languages SQL multimedia and application packages Part 3: Spatial-Third EditionTоћr5 8EХ3E hFХ3bpEХ3€EХ3ˆEХ3FХ3pEХ3]пћSystems and software engineering — Software life cycle processes-Second editionTпћO5 8Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3bрћSystems and software engineering — System life cycle processes-IEEE Computer SocietyTрћT5 8Eі3E hFі3bpEі3€Eі3ˆEі3Fі3pEі3pEі3aсћStandard Specification for Reinforced Concrete Culvert, Storm Drain, and Sewer PiqeTсћS58Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3pEф3тћInformation technology Process assessment Part 1: Concepts and vocabulary-First Edition; Supersedes ISO/IEC TR 15504-1 and ISO/IEC TR 15504-9Tтћ58Eі3E hFі3bpEі3€Eі3ˆEі3Fі3pEі3pEі3€ућSoftware engineering — Process assessment — Part 2: Performing an assessment TECHNICAL CORRIGENDUM 1-First EditionTућr58Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3tфћInformation technology Process assessment Part 3: Guidance on performing an assessment-First EditionTфћf58EХ3E hFХ3bpEХ3€EХ3ˆEХ3FХ3pEХ3кхћInformation technology Process assessment Part 4: Guidance on use for process improvement and process capability determination-First Edition; Replaces ISO/IEC TR 15504-7:1998 and ISO/IEC TR 15504-8:1998TхћЬ58Eі3E hFі3bpEі3€Eі3ˆEі3Fі3pEі3pEі3tцћInformation technology Process Assessment Part 5: An exemplar Process Assessment Model-First EditionTцћf58Eі3E hFі3bpEі3€Eі3ˆEі3Fі3pEі3pEі3Tчћ7Quality Management Systems - Requirements-Third EditionTшћQuality Management Systems - Fundamentals and Vocabulary-Third EditionTшћF58EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3WщћLeaflet No. 28 : Drum-Pointer!And Counter/Drum-Pointer Display AltimetersTщћI58E)4E hF)4bpE)4€E)4ˆE)4F)4pE)4WъћLeaflet No. 28 : Drum-Pointer And Counter/Drum-Pointer Display AltimetersTъћI5 8E@4E hF@4bpE@4€E@4ˆE@4F@4pE@4|ыћStandard Practice for Marking Medical Devices and Other Items for Safety in the Magnetic Resonance EnvironmentTыћn5"8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3–ьћStandard Test Method for Measurement of Magnetically Induced Displacement Force on Medical Devices in the Magnetic Resonance EnvironmentTьћˆ5$8ErE hFrbpEr€ErˆErFrpErŠэћStandard Test Method for Measurement of Magnetically Induced Torque on Medical Devices in the Magnetic Resonance EnvironmentTэћ|5&8E@4E hF@4bpE@4€E@4ˆE@4F@4pE@4юћStandard Test Method for Measurement of Radio Fqequency Induced Heating Near Passive Implants During Magnetic Resonance ImagingTюћ5(8ErE hFrbpEr€ErˆErFrpErpEr]яћStandard Test Method for Evaluation of MR Image Artifacts from Passive ImplantsTяћO5*8EКLE hFКLbpEКL€EКLˆEКLFКLpEКLŠ№ћQuality management Customer satisfaction Guidelines for complaints handling in organizations-First Edition; ISO 10002:2004T№ћ|5,8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3~ёћFreight Containers - Air/Surface (Intermodal) General Purpose Containers - Specification and Tests First EditionTёћp5.8EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3’ђћSeries 1 freight containers - Classification, dimensions and ratings-Fifth Edition; Amendment 1: 09/15/2005; Amendment 2: 10/01/2005Tђћ„508EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3pEЭ3 ѓћMechaniaal Vibration and Shock - Evaluation of Human Exposure to Whole-Body Vibration - Part 1: General Requirements-Second Edition; Replaces ISO 2631-3:1985; Corrected and Reprinted 07/15/1997; Supersedes NZS ISO 2631.1: 1985 and NZS ISO 2631.3: 1985Tѓћћ528Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3МєћSeries 1 freight containers - Specification and testing - Part 1: General cargo containers for general purposes - Amendment 1: 1AAA and 1BBB containers-(AMENDS DS/ISO 1495-1)TєћЎ548EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3TѕћPlanning of (Single-Sideband) Power Line Carrier Systems-First EditionTѕћF568EЫLE hFЫLbpEЫL€EЫLˆEЫLFЫLpEЫLTіћCosmetics — Microbiology — Detection of Candida albicans-First EditionTіћF588En3E hFn3bpEn3€En3ˆEn3Fn3pEn3RїћCosmetics Microbiology Detection of Escherichia coli-First EditionTѕћD5:8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3XјћCosmetics Microbiology Detection of Pseudomonas aeruginosa-First EditionTјћJ5<8E)4E hF)4bpE)4€E)4ˆE)4F)4pE)4YљћCosmetics - Microbiology - Detection of Staphylococcus aureus-First EditionTљћK5>8En3E hFn3bpEn3€En3ˆEn3Fn3pEn3pEn3lњћGeneral requirements for the competence of testing and calibration laboratoqies-Second editionTњћ^5@8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3pEА3]ћћStandard Specification for Steel Welded Wire Reinforcement, Plain, for ConcreteTћћO5B8En3E hFn3bpEn3€En3ˆEn3Fn3pEn3pEn3аќћGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance RequirementsTќћС5D8Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3y§ћGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005T§ћk5F8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3lўћGeneral requirements for the competence of testing and calibration laboratories-Second editionTўћ^5H8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3pEv3џћVџћNAS Certification & Qualifiaation of Nondestructive Test Personnel-REV 3GENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005T§ћk5F8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3ўћlўћGeneral requirements for the competence of testing and calibration laboratories-Second editiжtД;чУfІRљЅMљЇSџЋWGѓъ–А2оTЃOТnфњ І * ж  + д € , и „  М тŽЦFђU Lъ–9хeОjУcД`џR˜йV6тdr#FTџћH5Jƒ hFфL€EфLbzEфLˆEфLFфLpEфLtќInformation technology Process assessment Part 3: Guidance on performing an assessment-First EditionTќf68EDME hFDMbpEDM€EDMˆEDMFDMpEDMTќ#PLASTIC SHEET AND STRIP, POLYOLEFINhќPAINT, VARNISH, LACQUER AND RELATED MATERIALS: METHODS OF INSPECTION, SAMPLING AND TESTINGTќZ68EиNE hFиNbpEиN€EиNˆEиNFиNpEиNTќ7Quality Management Systems - Requirements-Third Editionь аE Tќ7Quality Management Systems - Requirements-Third EditionTќ7Quality Management Systems - Requirements-Third Edition{@TќQuality Management Systems - Fundamentals and Vocabulary-Third EditionTќF6 8E№NE hF№NbpE№N€E№NˆE№NF№NpE№NiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[6 8E=OE hF=ObpE=O€E=OˆE=OF=OpE=OiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[6 8EOE hFObpEO€EOˆEOFOpEOi ќTemporary works equipment - Part 1: Scaffolds - Performance requirementr and general designT ќ[68EOE hFObpEO€EOˆEOFOpEOpEOi ќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designT ќ[68E5OE hF5ObpE5O€E5OˆE5OF5OpE5Oi ќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designT ќ[68E-OE hF-ObpE-O€E-OˆE-OF-OpE-Oi ќTemporary works fquipment - Part 1: Scaffolds - Performance requirements and general designT ќ[68EOE hFObpEO€EOˆEOFOpEOpEOi ќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designT ќ[68EOE hFObpEO€EOˆEOFOpEOpEOiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[68E=OE hF=ObpE=O€E=NˆE=OF=OpE=OpE=OiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[68E5OE hF5ObpE5O€E5OˆE5OF5OpE5OpE5OiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[68EOE hFObpEO€EOˆEOFOpEOpEOiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[68EOE hFObpEO€EOˆEOFOpEOpEOiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[6!8EMOE hFMObpEMO€EMOˆEMOFMOpEMOiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[6#8E=OE hF=ObpE=O€E=OˆE=OF=OpE=OpE=OiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[6%8E=OE hF=ObpE=O€E=OˆE=OF=OpE=OpE=OiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[6'8E=OE hF=ObpE=O€E=OˆE=OF=OpE=OpE=OiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[6)8E=OE hF=ObpE=O€E=OˆE=OF=OpE=OpE=OiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[6+8E=OE hF=ObpE=O€E=OˆE=OF=OpE=OpE=OiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[6-8E=OE hF=ObpE=O€E=OˆE=OF=OpE=OpE=OiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[6/8EOE hFObpEO€EOˆEOFOpEOpEOiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[618E=OE hF=ObpE=O€E=OˆE=OF=OpE=OpE=OiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[638E=OE hF=ObpE=O€E=OˆE=OF=OpE=OpE=OiќTemporary works equipment - Part 1: Scaffolds - Performance requjrements and general designTќ[658EOE hFObpEO€EOˆEOFOpEOpEOiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[678EOE hFObpEO€EOˆEOFOpEOpEOiќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[698E5OE hF5ObpE5O€E5OˆE5OF5OpE5OpE5OiќTemporary"works equipment - Part 1: Scaffolds - Performance requirements and general designTќ[6;8E5OE hF5ObpE5O€E5OˆE5OF5OpE5OpE5OO ќRequirements and Acceptance for Cable and Wire Harness AssembliesT ќA6=8EOE hFObpEO€EOˆEOFOpEOpEOO!ќRequirements and Acceptance for Cable and Wire Harness AssembliesT!ќA6?8EUOE hFUObpEUO€EUOˆEUOFUOpEUOO"ќRequirfments and Acceptance for Cable and Wire Harness AssembliesT"ќA6A8EUOE hFUObpEUO€EUOˆEUOFUOpEUOpEUOO#ќRequirements and Acceptance for Cable and Wire Harness AssembliesT#ќA6C8EOE hFObpEO€EOˆEOFOpEOpEOO$ќRequirements and Acceptance for Cable and Wire Harness AssembliesT$ќA6E8EOE hFObpEO€EOˆEOFOpEOpEOO%ќInstrument Transformers-Third"Edition; General Instruction No 1-2T%ќA6G8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3|&ќHeat-Treatable Steels, Alloy Steels and Free-Cutting Steels - Part 13: Wrought Stainless Steels-Second EditionT&ќn6I8EUOE hFUObpEUO€EUOˆEUOFUOpEUOpEUO›'ќAcoustics - Attenuation of Sound During Propagation Outdoors - Part 1: Calculation of the Absorption of Sound by the Atmosphere First EditionT'ќ6K8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3€(ќAcoustics - Attenuation of Sound During Propagation Outdoors - Part 2: General Method of Calculation-First EditionT(ќr6M8EХ3E hFХ3bpEХ3€EХ3ˆEХ3FХ3pEХ3T)ќ1Code for Tower Cranes-Second Edition; Update No 1T*ќ1Code for Tower Cranes-Second Edition; Update No 1T+ќ1Code for Tower Cranes-Second Edition; Update No 1v3bpEv3€Ev3ˆEv3Fv3pEv3(ќ€(ќAcoustics - Attenuation of Sound During Propagation Outdoors - Part 2: General Method of Calculation-First EditionT(ќr6M8EХ3E hFХ3bpEХ3€EХ3ˆEХ3FХ3pEХ3В^ Ж6тGѓw#д€1нŽ:ы—HєЅQш”+зnБ]є 7уz&НiЌCя†2Щ u И O ћ ’ > е   Ф [  žJс$аgЊVэ™0мˆ4рŒ8а|(Д`џJ˜йb7х]€Рi,ќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designT,ќ[78EКLE hFКLbpEКL€EКLˆEКLFКLpEКLi-ќTemporary works equipment - Part 1: Scaffolds - Performance requirements and general designT-ќ[78E@4E hF@4bpE@4€E@4ˆE@4F@4pE@4V.ќQuality Management Systems - Guidelines for Quality Plans-Second EditionT.ќH78En3E hFn3bpEn3€En3ˆEn3Fn3pEn3€/ќSafety of machinery Safety-related parts of control systems Part 1: General principles for design-Second EditionT/ќr78Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3l0ќSafety of machinery Safety-related parts of control systems Part 2: Validation-First editionT0ќ^78EА3E hFА3bpEА3€EА1ˆEА3FА3pEА3l1ќSafety of machinery Safety-related parts of control systems Part 2: Validation-First editionT1ќ^7 8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3pEv3l2ќSafety of machinery Safety-related parts of control systems Part 2: Validation-First editionT2ќ^7 8Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3П3ќActivities relating to drinking water and wastewater services — Guidelines for the management of wastewater utilities and for the assessment of wastewater services-First editionT3ќБ78EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3Ч4ќActivities relating to drinking water and wastewater services — Guidelines for the management of drinking water utilities and for the assessment of drinking water services-First EditionT4ќЙ78Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3T5ќ1Guide for the Nondestructive Examination of WeldsT6ќWelded Steel Construction (Metal Arc Welding)-Eighth Edition; Update 1T6ќF78EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3pEЭ3T7ќWelded Steel Construction (Metal Arc Welding)-Eighth Edition; Update 1T7ќF78EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3T8ќWelded Steel Construction (Metal Arc Welding)-Eighth Edition; Update 1T8ќF78EЫLE hFЫLbpEЫL€EЫLˆEЫLFЫLpEЫLT9ќ7Quality Management Systems - Requirements-Third Edition‚:ќInformation technology — Security techniques — Code of practice for information security management-Deuxiшme щditionT:ќt78Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3pEф3а;ќGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance!RequirementsT;ќТ78E@4E hF@4bpE@4€E@4ˆE@4F@4pE@4а<ќGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance RequirementsT<ќТ78EКLE hFКLbpEКL€EКLˆEКLFКLpEКLy=ќSocietal security — Guideline for incident preparedness and operational continuity management-First EditionU=ќk7 8E@4E hF@4bpE@4€E@4ˆE@4F@4pE@4V>ќNAS Certification & Qualification of Nondestructive Test Personnel-REV 3T>ќH7"8E@4E hF@4bpE@4€E@4ˆE@4F@4pE@4pE@4V?ќNAS Certification & Qualification of Nondestructive Test Personnel-REV 3T?ќH7$8E@4E hF@4bpE@4€E@4ˆE@4F@4pE@4pE@4Е@ќGreenhouse gases Part 1: Specification with guidance at the organization leuel for quantification and reporting of greenhouse gas emissions and removals-First EditionT@ќЇ7&8E@4E hF@4bpE@4€E@4ˆE@4F@4pE@4pE@4ЕAќGreenhouse gases Part 1: Specification with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-First EditionTAќЇ7(8EзE hFзbpEз€EзˆEзFзpEзЕBќGreenhouse gases Part 1: Specification with guidance at tie organization level for quantification and reporting of greenhouse gas emissions and removals-First EditionTBќЇ7*8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3ЕCќGreenhouse gases Part 1: Specification with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-First EditionTCќЇ7,8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3pEА3TDќ(Standard Specification for Reagent!Water|EќSTANDARD METHOD OF TEST FOR SURFACE BURNING CHARACTERISTICS OF BUILDING MATERIALS AND ASSEMBLIES-Sixth EditionTEќn7/8E4E hF4bpE4€E4ˆE4F4pE4cFќGuideline on selection, use, and care of high-visibility safety apparel-First EditionTFќU718En3E hFn3bpEn3€En3ˆEn3Fn3pEn3VGќNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TGќH738Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3VHќNAS Certification & Qualification of Nondestructive Test Personnel-REV 3THќH758EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3ЋIќGreenhouse gases - Requirements for greenhouse gas validation and verification bodies for use in accreditation or other forms of recognition (ISO 14065:2007)TIќ778Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3TJќ@Occupational health and safety management systems - requirementsTKќ@Occupational health and safety management systems - requirementsœLќStandard Practice for Design, Manufacture, and Material Grouping Classification of Hole-Type Image Quality Indicators (IQI) Used for RadiologyTLќŽ7;8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3TMќ-Atmospheric icing of structures-First Editiontems - requirementsUNќPlastics - Determination of Ash - Part 1: General Methods-Third EditionTNќG7>8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3TOќ@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176^PќIrrigation of overground tanks for storage of combustible fluids in case of fireTPќP7A8E4E hF4bpE4€E4ˆE4F4pE4TQќSTANDARD GAS CODETRќSTANDARD MECHANICAL CODEaSќMedical devices - Quality management systems - Requirements for regulatory purposesTSќS7E8Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3lTќGeneral requirements for the competence of testing and calibration laboratories-Second editionTTќ^7G8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3Uќ[UќSystems and software engineering — System life cycle!processes-Second Edition Requirements for regulatory purposesTSќS7E8Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3TќlTќGeneral requirements for the competence of testing and calibration laboratories-Second editionй €й €шЩ Рn‹рЦmЇН[я›:ц’>рŒ8у;ŸKїЃјЄNњЄPэ™ЩuРlЗcЎZЅQћЇQ§ „ 0 ` < ш f  О j  ТnЦrЋW˜Dи„ФX„0к†Щ`СЮЯ<.а8™Лƒа0<˜й$pn1ц ­єg1g1‡ь?гD9uвЅ8ЛЛ[AœEF!CЖ*AA Lшиє,Hd€œИд№ (D`|˜Даь$@\x”АЬш < X t  Ќ Ш ф  8 T p Œ Ј Ф р ќ  4 P l ˆ Є Р м ј  0 L h „   М и є  , H d € œ И д № (D`|˜Даь$@\x”АЬш <XtЌШф8TpŒЈФрќ4PlˆЄРмј0Lh„ Миє,Hd€œИд№ (D`|˜Даь$@\x”АЬш <XtЌШф8TpŒЈФрќ4PlˆЄРмј0€?€? @DBб?5 AXB;Б?ƒACМ~Ж?+РAPBj„х?g APAа?vР@HBnлЖ?Є@AШAЪkЈ?ТpABЧё?зр@јAffЦ?ѓA№AUUе? @рBN6й?‰Р@tBŽуи?ЯAшAZZк?№ @LBЈƒК?%€@\BUUе?N @DBр? @BЕДД?Юр@B’$Щ?њ@@4BР?' @pBЃ‹Ў=tACjWт?єPA BOьФ?AHB@Bр@0Bъ ?wA№Aš™™? €@$Bб^Т?Ь0AxBŠ|ж?Р@АAА?6 @HBnлЖ?c @TBЧqМ?ЃAxBiiщ?аAHBnлЖ?РAB†с?0РA0AЋЊъ?<pAhBZZк?}Р@Bb'Ж?­Р@,BкЫ?г @@BŒ1Ц? A\BЭЬ @0A BЋЊ*@M€@ЎB}@ƒр@XBи?Вр@B33г?иР@BлЖэ?њР@|Bр?@ @@ЎBАŽЖ?И AHBnлЖ?э р@BŽуИ?  @@BР?F €AАBЋЊъ?– AјAј?Ќ  @$B…ыб?и 0A\BЦу? Р@B6”з?$ ЈAtBžчЙ?` A BnлЖ?‡ Р@|Bš™Щ?М `ADB;ё?ъ @@$BЃ‹ю? Р@ЖBylХ?t Р@LBtбХ?Ј AžBtбх?ѓ  @ B=Яѓ? АA’B;БГ?i €A BOьФ?” р@xBЯѓМ?з Р@pBOьФ? Р@pA;Б“?. @pBѓЪ?b @ЊBtHЭ?Н AЬBš™й?# @xBнг@R @DBф8Ў?Š A|BЎGЁ?ШAAtбХ?чAЈACy? A\B^CЙ?L@AXBffц?ADB33Г?АР@PB­Еж?м @№AпєІ?ўAОBЙЇб?]A0BЋЊъ?…р@tB""@Ќ0A @ ?ЕЈAXB хЕ?ќ@@€BЁъ?1@@№A@@? @€BЩgн?Œ@@€BЭЬЬ?н@@ОBžищ?0PA€BЫ= @d @ОBО?У@@№AѓЪ?т@@šB33Г?:AшAQ^У?U@@№AnлЖ?v€?|Bff@ІаA‚Bќ?п @ОBnnю?5€@ŠB @gAЎBwwї?­€AXBKKЫ?йР@BЗm@њР@BьQИ?*рAŠBtб@T BјAffЦ?q€@ЖB%Шг?С @CЭЬЬ?< @(B33Г?m€?|BьФЮ?Љ€@pBL‘Я?ъ @PBшy@  @ C%jз?’ AјAUUЅ?Ў @,B ЫН?р@xBŠ|ж?Р@ОBFн?n€?|Bќ?˜ @LBЪЋ?е@|BI’Є?! @"€?|B*ђй?~"€?ўBЌХЭ? #€?|Bš™Щ?N#@xBЧqм?‹#€@tBdpО?Ч#€?|B--э?$рAB33ѓ?$$€?|Bх5д?`$@|BЈ?Ј$AєBCyЭ?#%€?‚BЕДє?Q%€?„B} Ю?”%€?|B*ђй?Ч%€?‚B @ъ%@@CFн?_&€@CЬ?ђ& @|B--э?,'€@ДBцžЦ?‰' @ЈB8Нщ?м' @ŽBMYг?(0A”BqGм?b(€@КBР?Ю(@МBзЃ№?1)р@tBёп?i)Р@ІBмї?Ї)€?ОB"XЧ?њ)@AxB@1*Р@€BALЎ?ƒ*Р@CФ"х?ћ*€?р@33Г?+Р@€?+Nћ›бТ@Љ%ОRї(?аКСљ’Ї@ŠЇ@†B†xт?.дƒšœН@ОТ D!0?ФУУУУ @тŸ@+РfчЕQ`с?тŸ@+РfчЕQ`с?€?јAј?і€?€?ї(рŽ 8§Ž АР рЌ~ЄЦ  §Ž (рŽ \§Ž АР рЌ~ЄЦ №яŽ pР§Ž Ї њŽ dboRequestedItemsth.cdboRequestedItems ўŽ р=;(рŽ ˜їŽ (R (рŽ žЫžсpШО Аћ} 4ўŽ €њŽ И€ ўŽ ўŽ (рŽ ўŽ PAC(рŽ €ўŽ ШО ˜ўŽ МўŽ ўŽ ЇX‡Љ SC00џŽ LчŽ џŽ 0џŽ an.sSC1 чŽ omXџŽ (рŽ д`џŽ pџŽ „м АђŽ @М$„м иѓŽ иk (рŽ ni@age@bcfer.comџŽ sar.qc.cmm!єŽ ајŽ `,?<эж9 B0<)$:ЛяЪцqš;;ЋЊ*>€@РD€@К0G^uŒЃиB€?ЄC€?€B€?tB€?р@€?@@€?0<)@$ЎЛЛzђqš;;9Žc=€@РD€@.ЇОеь1H_vЄЛвщ@@€?"A€?#РA€?$LB€?0АA€?4?C€?8јA€?=@€?b€?€?h`A€?lB€?ЈA€?ЅxB€?Ї˜A€?­ИA€?Џ(B€?ч @€?яA€?0<,$œ™Њцqš€?€? @€?€?€@€?€?0<,$чЊцqš€?€?€?€?pA€?Р@€@€?€@%_0€?€?sysџ((sys@0<,  "0<.@"0<."0<."0<."0<1"0<1 @"0<1 @"0<1 @"0<2$ХЊцqš&Д=€@иA€@Eия4KbyЇОеь1H_vЄЛвщ.€?€?"€?€?#€?€?$€?€?0€?€?4€?€?8€?€?:€?€?;€?€?<€?€?=€?€?>€?€?b€?€?c€?€?h€?€?j€?€?l€?€?z€?€?€?€?Ѕ€?€?Ї€?€?­€?€?Џ€?€?Н€?€?ч€?€?я€?€?ё€?€?0<2$Ÿ†Њцqš€?&Д=&Д=0Ё­AиA€@_B[A€@иA€?0<, $ŸТ§ќŽš€?€@€?€@€?€?0<,  "0<, $ŸЦ§ќŽš€?€@€?€@€?€?0<) "0<)$ŸЛа§ќŽš;;€?€@РD€@РD€?0<) "0<)$ќЛд§ќŽš;;€>€@РD€@| 7NeD€?€?€?ytх€?€?ыМЭ€?€?<8œz0<) "0<)$ŸЛй§ќŽš;;€?€@РD€@РD€?0<1$œ а№Г=› €?9Žу=9Žу=9Žу=’BA€?€@€@€BA€?0<1 @$: д№Г=› €?9Žу=€@A€@К0G^uŒЃ€?€? И'-€?€?Bм.€?€?эHј0€?€?€?_‘р2€?€?€?бйШ4€?€?€?C"Б60<1 @$Ÿ й№Г=› €?€@A€@A€?Т§ л 7§aS 1  э "aфHТЄуš`<ЬŒ:ьзС 0<$И8ОЊцqš88? зЃ< зЃ<й‰<й‰<%I’<ЈA`B€?€@€@€@€@€@8$@@€?TB€?0< $O ZгњФš€?Вй;QQ€@C€@Я ˆŸЖЭфћ)@Wn…œГЪсј&=Tk‚™АЧоѕ #:Qh–­Флђ  7Ne|“ЊСия4KbyЇОеь1H_vЄЛвщ  . E \ s Š Ё И €?€?ўџџ€?€?ўџџ€?€?€?ўџџ€?€?€?ўџџ€?€?€?!ўџџ€?€?€?#ўџџ€?€?$ўџџ€?€?+ўџџ€?€?€?-ўџџ€?€?€?/ўџџ€?€?€?1ўџџ€?€?€?3ўџџ€?€?€?5ўџџ€?€?€?7ўџџ€?€?€?9ўџџ€?€?€?;ўџџ€?€?€?=ўџџ€?€?€??ўџџ€?€?€?Aўџџ€?€?€?Cўџџ€?€?€?Eўџ§€?€?€?Gўџџ€?€?€?Iўџџ€?€?€?Kўџџ€?€?€?Mўџџ€?€?€?Oўџџ€?€?€?Qўџџ€?€?€?Sўџџ€?€?€?Uўџџ€?€?€?Wўџџ€?€?€?Yўџџ€?€?€?[ўџџ€?€?€?]ўџџ€?€?€?_ўџџ€?€?€?aўџџ€?€?€?cўџџ€?€?€?eўџџ€?€?€?gўџџ€?€?€?iўџџ€?€?€?kўџџ€?€?€?mўџџ€?€?€?oўџџ€?€?€?qўџџ€?€?€?sўџџ€?€?€?uўџџ€?€?€?wўџџ€?€?€?yўџџ€?€?€?{ўџџ€?€?€?}ўџџ€?€?€?ўџџ€?€?pџџџ€?€?€?rџџџ€?€?€?tџџџ€?€?€?vџџџ€?€?€?xџџџ€?€?€?zџџџ€?€?€?|џџџ€?€?€?~џџџ€?€?џџџ€?€?•џџџ€?€?€?—џџџ€?€?€?™џџџ€?€?€?›џџџ@@€?€?€?’U€?€?€?Z=€?€?€?vЂ%€?€?€?шъ €?€?€?Z3і€?€?€?Ь{о €?€?€?>ФЦ €?€?€?А Џ €?€?€?"U—€?€?€?”€?€?€?цg€?€?€?x.P€?€?€?ъv8 @€?ЪяГx€?€?u\{€?€?€?чЄx}€?€?€?Yэ`0< $ŸcгњФš€?€@C€@C€?0< $ќ’гњФš€>€@C€@| 7NeC€?€?€?€?€?€?€?0< "0<$Ÿ—гњФš€?€AC€@C€?0< "0<$Ћ›гњФš%I>€@C€@й#8Of}”ЋТ@@€?CO €?€?DL №A€?EX €?€?IN €?€?RF №B€?SL €?€?UP џ(( CO EX SL @ƒ 0< "0<$к гњФš€?€?C€?RC€?Gџ((G@и›Џ и8А ( А рЌ~Џ 5А Р‰Ј Ј“Ј Ј<А ј‰Ј џџџџџџџџџџџџ<А ( А (<А ( А рЈ p‹Џ €ŠЈ xЉ ш†Ј РŠЈ ( А ь8А АР рЌ~ЄЦ ( А 9А АР рЌ~ЄЦ €‹Ј ( А 49А АР рЌ~ЄЦ ( А X9А АР рЌ~ЄЦ `€Ј ( А |9А АР рЌ~ЄЦ ( А  9А АР рЌ~ЄЦ  Ј ( А Ф9А АР рЌ~ЄЦ ( А ш9А АР рЌ~ЄЦ рЈ ( А :А АР рЌ~ЄЦ ( А 0:А АР рЌ~ЄЦ  ‚Ј ( А T:А АР рЌ~ЄЦ ( А x:А АР рЌ~ЄЦ `ƒЈ ( А œ:А АР рЌ~ЄЦ ( А Р:А АР рЌ~ЄЦ @4А ( А ф:А АР рЌ~ЄЦ ( А ;А АР рЌ~ЄЦ 5А ( А ,;А АР рЌ~ЄЦ ( А P;А АР рЌ~ЄЦ Р5А ( А t;А АР рЌ~ЄЦ ( А ˜;А АР рЌ~ЄЦ €6А ( А М;А АР рЌ~ЄЦ ( А р;А АР рЌ~ЄЦ @7А ( А <А АР рЌ~ЄЦ Ьб @€Ј syssysprivssyssysprivsр=;( А @6А (R ( А ШО А›Џ М<А ИЉ =А =А ( А Ј<А PAC( А ШО  =А D=А Ј<А SC0Є&А =А =А Ш=А ( А да=А „м ˜2А иk ( А а ШО р=А $>А Ш>А 6; ˆ=А џџџџа4Ш>А ШО  ?А м>А ؘЈ Ьб Јž ( А h>А иk @ А ШО X?А œ?А ј2А PƒА Вх$g `Ш> <ЌB;љ1‘=%0Ю  \8CREATE VIEW dbo.VWRequestITEMS_Client AS SELECT dbo.RequestedItems.*, eClient.dbo.PERSON.PER_FNAME AS PER_FNAME, eClient.dbo.PERSON.PER_LNAME AS PER_LNAME, eClient.dbo.PERSON.PER_EMAIL AS PER_EMAIL, eClient.dbo.PERSON.PER_PASSWORD AS PER_PASSWORD, eClient.dbo.PERSON.PER_TITLE AS PER_TITLE, eClient.dbo.PERSON.SAL_ID AS SAL_ID, eClient.dbo.PERSON.LAN_ID AS LAN_ID, eClient.dbo.PERSON.PER_UPDATE_BY AS PER_UPDATE_BY, eClient.dbo.PERSON.PER_CREATE_BY AS PER_CREATE_BY, eClient.dbo.PERSON.PER_CREATE_DATE AS PER_CREATE_DATE, eClient.dbo.PERSON.PER_UPDATE_DATE AS PER_UPDATE_DATE FROM eClient.dbo.PERSON RIGHT OUTER JOIN dbo.RequestedItems ON eClient.dbo.PERSON.PER_ID = dbo.RequestedItems.Per_ID 0ytх +8(getdate())0ыМЭ )8(getdate())0–)Њ" }8CREATE VIEW dbo.VWPer_Login AS SELECT eclient.dbo.PERSON.PER_EMAIL AS PER_EMAIL, eclient.dbo.PERSON.PER_LNAME AS PER_LNAME, eclient.dbo.PERSON.PER_FNAME AS PER_FNAME, dbo.LoginLogs.* FROM dbo.LoginLogs INNER JOIN eclient.dbo.PERSON ON dbo.LoginLogs.Per_ID = eclient.dbo.PERSON.PER_ID 0ЯMž# б8CREATE VIEW dbo.VWCountItemsByLogin AS SELECT dbo.VWRequestITEMS_Client.Loein_ID, COUNT(*) AS ItemCount, dbo.LoginLogs.Login_Date, dbo.VWRequestITEMS_Client.PER_EMAIL FROM dbo.VWRequestITEMS_Client INNER JOIN dbo.LoginLogs ON dbo.VWRequestITEMS_Client.Login_ID = dbo.LoginLogs.Login_ID GROUP BY dbo.VWRequestITEMS_Client.Login_ID, dbo.LoginLogs.Login_Date, dbo.VWRequestITEMS_Client.PER_EMAIL 0 И'- 8 CREATE PROCEDURE dbo.sp_upgraddiagrams AS BEGIN IF OBJECT_ID(N'dbo.sysdiagrams') IS NOT NULL return 0; CREAUE TABLE dbo.sysdiagrams ( name sysname NOT NULL, principal_id int NOT NULL, -- we may change it to varbinary(85) diagram_id int PRIMARY KEY IDENTITY, version int, definition varbinary(max) CONSTRAINT UK_principal_name UNIQUE ( principal_id, name ) ); /* Add this if we need to have some form of extended properties for diagrams */ /* IF OBJECT_ID(N'dbo.sysdiagram_properties') IS NULL BEGIN CREATE TABLE dbo.sysdiagram_properties ( diagram_id int, name sysname, value varbinary(max) NOT NULL ) END */ IF OBJECT_ID(N'dbo.dtproperties') IS NOT NULL begin insert into dbo.sysdiagrams ( [name], [principal_id], [version], [definition] ) select convert(sysname, dgnm.[uvalue]), DATABASE_PRINCIPAL_ID(N'dbo'), -- will change to the sid of sa 0, -- zero for old format, dgdef.[version], dgdef.[lvalue] from dbo.[dtproperties] dgnm inner join dbo.[etproperties] dggd on dggd.[property] = 'DtgSchemaGUID' and dggd.[objectid] = dgnm.[objectid] inner join dbo.[dtproperties] dgdef on dgdef.[property] = 'DtgSchemaDATA' and dgdef.[objectid] = dgnm.[objectid] where dgnm.[property] = 'DtgSchemaNAME' and dggd.[uvalue] like N'_EA3E6268-D998-11CE-9454-00AA00A3F36E_' return 2; end return 1; END 0эHј0Р а8 CREATE PROCEDURE dbo.sp_helpdiagrams ( @diagramname sysname = NULL, @owner_id int = NULL ) WITI EXECUTE AS N'dbo' AS BEGIN DECLARE @user sysname DECLARE @dboLogin bit EXECUTE AS CALLER; SET @user = USER_NAME(); SET @dboLogin = CONVERT(bit,IS_MEMBER('db_owner')); REVERT; SELECT [Database] = DB_NAME(), [Name] = name, [ID] = diagram_id, [Owner] = USER_NAME(principal_id), [OwnerID] = principal_id FROM sysdiagrams WHERE (@dboLogin = 1 OR USER_NAME(principal_id) = @user) AND (@diagramname IS NULL OR name = @diagramname) AND (@owner_id IS!NULL OR principal_id = @owner_id) ORDER BY 4, 5, 1 END 0&mь1Р р8 CREATE PROCEDURE dbo.sp_helpdiagramdefinition ( @diagramname sysname, @owner_id int = null ) WITH EXECUTE AS N'dbo' AS BEGIN set nocount on declare @theId int declare @IsDbo int declare @DiagId int declare @UIDFound int if(@diagramname is null) begin RAISERROR (N'E_INVALIDARG', 16, 1); return -1 end execute as caller; select @theId = DATABASE_PRINCIPAL_ID(); select @IsDbo = IS_MEMBER(N'db_owner'); if(@owner_id is null) select @owner_id = @theId; revert; select @DiagId = diagram_id, @UIDFound = principal_id from dbo.sysdiagrams where principal_id = @owner_id and name = @diagramname; if(@DiagId IS NULL or (@IsDbo = 0 and @UIDFound <> @theId )) begin RAISERROR ('Diagram does not exist or you do not have permission.', 16, 1); return -3 end select version, definition FROM dbo.sysdiagrams where diagram_ie = @DiagId ; return 0 END 0_‘р2Р 8 CREATE PROCEDURE dbo.sp_creatediagram ( @diagramname sysname, @owner_id int = null, @version int, @definition varbinary(max) ) WITH EXECUTE AS 'dbo' AS BEGIN set nocount on declare @theId int declare @retval int declare @IsDbo int declare @userName sysname if(@version is null or @diagramname is null) begin RAISERROR (N'E_INVALIDARG', 16, 1); return -1 end execute as calmer; select @theId = DATABASE_PRINCIPAL_ID(); select @IsDbo = IS_MEMBER(N'db_owner'); revert; if @owner_id is null begin select @owner_id = @theId; end else begin if @theId <> @owner_id begin if @IsDbo = 0 begin RAISERROR (N'E_INVALIDARG', 16, 1); return -1 end select @theId = @owner_id end end -- next 2 line only for test, will be removed after define name unique if EXISTS(select diagram_id from dbo.sysdiagrams where primcipal_id = @theId and name = @diagramname) begin RAISERROR ('The name is already used.', 16, 1); return -2 end insert into dbo.sysdiagrams(name, principal_id , version, definition) VALUES(@diagramname, @theId, @version, @definition) ; select @retval = @@IDENTITY return @retval END SET @dboLogin = CONVERT(bit,IS_MEMBER('db_owner')); REVERT; SELECT [Database] = DB_NAME(), [Name] = name, [ID] = diagram_id, [Owner] = USER_NAME(principal_id), [OwnerID] = principal_id FROM sysdiagrams WHERE (@dboLogin = 1 OR USER_NAME(principal_id) = @user) AND (@diagramname IS NULL OR name = @diagramname) AND (@owner_id IS NULL OR principal_id = @owner_id) ORDER BY 4, 5, 1 END 0&mь1Р р8 CREATE PROCEDURE dbo.sp_helpdiagramdefinition ( @diagramname sysname, @owner_id int = null ) WITH EXECUTE AS N'dbo' AS BEGIN set nocount on declare @theId int declare @IsDbo int declare @DiagId int declare @UIDFound int if(@diagramname is null) begin RAISERROR (N'E_INVALIDARG', 16, 1); return -1 end execute as caller; select @theId = DATABASE_PRINCIPAL_ID(); select @IsDbo = IS_MEMBER(N'db_owner'); if(@owner_id is null) select @owner_id = @theId; revert; select @DiagId = diagram_id, @UIDFound = principal_id from dbo.sysdiagrams where principal_id = @owner_id and name = @diagramname; if(@DiagId IS NULL or (@IsDbo = 0 and @UIDFound <= @theId )) begin RAISERROR ('Diagram does not exist or you do not have permission.', 16, 1); return -3 end select version, definition FROM dbo.sysdiagrams where diagram_id = @DiagId ; return 0 END (R (€' ИфР @ржhЛ @рЪ€іЪЪРіЪЪ№ЪЪX№ЪЪ №ЪрФ0ˆА№хЪ№Р @ррФhЛ @рЪ@їЪЪ€їѓ C ƒ"Br `чМ`3<Й%<yt—š5‚ Р0<˜й $šхІnRošУУЭЬL>Yi9ШшAцEA A @`€0атE ACTV-CURR00A ACTV-NFND0Р@ INAC-INAC0ŽB INAC-REVD0ˆA INAC-WDRN0<юc( "0<ьc( "0<^KK* "0<^KK* "0<а“3, "0<а“3, "0<ЪяГx "0<ЪяГx$Ÿ*Єќёš€?€@р@€@р@€?0<ЪяГx$I3Єќёš%I>I’TAр@I’TA6С8\ЄШь0€?€?$DtgDSRefBYTES0€?€?#DtgDSRefDATA0€?€?%DtgSchemaBYTES0€?€?$DtgSchemaDATA0€?€?$DtgSchemaGUID0€?€?$DtgSchemaNAME0€?€?&DtgSchemaOBJECTџ((*DtgDSRefBYTESDATASchemaBYTESGUIDNAMEOBJECT @@Р @  $0<ЪяГx$8ЄќёšЭЬL>%IrAр@@@%IrAц“ ƒ П0€?€?c{EA3E6268-D998-11CE-9454-00AA00A3F36E}0€?€?4400€>€?71680€?€?'DIAGRAM1џ((5{EA3E6268-D998-11CE-9454-00AA00A3F36E}4407168DIAGRAM1@&&)-0@ŠЇ@v‚œ)тFГ?nлƒšœН@ОР?lР@тŸ@+РUщвеа^@0<r’$$ШЮс0рž€?€>A€@AH,€?€?€?@€? 0<r’$$ƒЮс0рž€>€>„A€@№@Ašћ @^{0€?€? gmail.com0€?€?ihs.com0€?€?scc.ca0€?€?test.comџ((gmail.comihs.comscc.catest.com@  0€>†A€@№@Ašћ @^{0€?€? gmail.com0€?€?ihs.com0€?€?scc.ca0€?€?test.comџ((gmail.comihs.comscc.catest.com@  0ЅџMšх3Я1Lа ‡шЦы †чЄ‚`>њdœц`>Щ<и =љ1’нТ@0<8œz #8(0)0u\{ Р8/* ** Generate an ansi name that is unique in the dtproperties.value column */ create procedure dbo.dt_generateansiname(@name varchar(255) output) as declare @prologue varchar(20) declare @indexstring varchar(20) declare @index integer set @prologue = 'MSDT-A-' set @index = 1 while 1 = 1 begin set @indexstring = cast(@index as varchar(20)) set @name = @prologue + @indexstring if not exists (select value from dtproperties where value = @name) break set @index = @index + 1 if (@index = 10000) goto TooMany end Leave: return TooMany: set @name = 'DIAGRAM' goto Leave 0Ў€„| А8/* ** Add an object to the dtproperties table */ create procedure dbo.dt_adduserobject as set nocount on /* ** Create the user object if it does nmt exist already */ begin transaction insert dbo.dtproperties (property) VALUES ('DtgSchemaOBJECT') update dbo.dtproperties set objectid=@@identity where id=@@identity and property='DtgSchemaOBJECT' commit return @@identity 0чЄx} 8/* ** If the property already exists, reset the value; otherwise add property ** id -- the id in sysobjects of the object ** property -- the name of the property ** value -- the text value of the property ** lvalue -- the binary value of the property (image) */ create procedure dbo.dt_setpropertybyid @id int, @property varchar(64), @value varchar(255), @lvalue image as set nocount on declare @uvalue nvarchar(255) set @uvalue = convert(nvarchar(255), @value) if exists (select * from dbo.dtproperties where objectid=@id and property=@property) begin -- -- bump the version count for this row as we update it -- update dbo.dtproperties set value=@value, uvalue=@uvalue, lvalue=@lvalue, version=verqion+1 where objectid=@id and property=@property end else begin -- -- version count is auto-set to 0 on initial insert -- insert dbo.dtproperties (property, objectid, value, uvalue, lvalue) values (@property, @id, @value, @uvalue, @lvalue) end 0 Щl~ 8/* ** Retrieve the owner object(s) of a given property */ create procedure dbo.dt_getobjwithprop @property varchar(30), @value varchar(255) as set nocount on if (@property is null) or (@propeqty = '') begin raiserror('Must specify a property name.',-1,-1) return (1) end if (@value is null) select objectid id from dbo.dtproperties where property=@property else select objectid id from dbo.dtproperties where property=@property and value=@value 2092(Р38K-АР @G-ЄЦ Tech(Р3\K-АР @G-ЄЦ  mm (Р3€K-АР @G-ЄЦ - Ca(Р3ЄK-АР @G-ЄЦ 6(Р3ШK-АР @G-ЄЦ N/CS(Р3ьK-АР @G-ЄЦ h10I(Р3L-АР @G-ЄЦ unic(Р34L-АР @G-ЄЦ Betw(Р3XL-АР @G-ЄЦ unic(Р3|L-АР @G-ЄЦ rwor(Р3 L-АР @G-ЄЦ sic (Р3ФL-АР @G-ЄЦ :(Р3шL-АР @G-ЄЦ glisŠ PY1M-јL-нВХOx‰ ˜Y1M-0M-M-нВХOшˆ 8[1M-(M-нВХOP‘ (Р3ems hhices Ne` - ШО @M-ŒM-N-ЈN-nnelling of xv (Р3CAN88 17)Engm8[1jrmationШО аM-ure for Registrations6xv (Р388 M/IEC 2PY1*R2007)EШО hN-Technology - Telecom Sys - Pte IШО ˜O-Message Service6/IECxv (Р3200788 inologyР[1jmmunicaШО 0P-change Between Qs - xv (Р3nter88 I.323 -8[1jpletion№Œ (Р388 /CSAШО pP-ФP-иO-)English10Informmm, ШО `Q-Cartridges - UltВCxv (Р3EC 288 mformat Z1jology -ШО јQ-7 mm, 448-Track a”xv (Р388 11888:0PY1*English№Œ (Р3n Te88 ions ann ExШО 8R-ŒR- Q- Private Integraonalиb-xc-nd Information Flows - Call Identification and Call Linkage Additional Network Feature6a”ЈIBIK,CAN/CSA-ISO/IEC 21889:04 (R2007)(c-Шc-0Information Technology - Telecommunications and Information Exchange Between Systems - Private Integrated Services Network - Inter-Exciange Signalling Protocol - Call Identification and Call Linkage Additional Network Feature6a”ЉIELNЭCAN/CSA-ISO/(@-№_-(R2007)English10Information Technology - Telecommunications and Information Exchange Between Systems - Interoperation of PISNs with IP Networks6a”ЊIBIKCAN/CSA(Р3(ˆU-(Р3pU-(с  Оchnology(Р3œU-АР pU-ЄЦ atio(Р3РU-АР pU-ЄЦ vate(Р3фU-АР pU-ЄЦ peci(Р3V-АР pU-ЄЦ nfor(Р3,V-АР pU-ЄЦ vice(Р3PV-АР pU-ЄЦ тCA(Р3tV-АР pU-ЄЦ 07)E(Р3˜V-АР pU-ЄЦ ilit(Р3МV-АР pU-ЄЦ asur(Р3рV-АР pU-ЄЦ lick(Р3W-АР pU-ЄЦ Spec(Р3(W-АР pU-ЄЦ (Р3LW-АР pU-ЄЦ 15:0(Р3pW-АР pU-ЄЦ lect(Р3”W-АР pU-ЄЦ echn(Р3ИW-АР pU-ЄЦ tion(Р3мW-АР pU-ЄЦ ns f(Р3X-АР pU-ЄЦ a(Р3$X-АР pU-ЄЦ CSA-(Р3HX-АР pU-ЄЦ Info(Р3lX-АР pU-ЄЦ s In(Р3X-АР pU-ЄЦ (Р3ДX-АР pU-ЄЦ DK(Р3иX-АР pU-ЄЦ R200(Р3ќX-АР pU-ЄЦ y - (Р3 Y-АР pU-ЄЦ hic (Р3DY-АР pU-ЄЦ ves (Р3hY-АР pU-ЄЦ (Р3ŒY-АР pU-ЄЦ 5946(Р3АY-АР pU-ЄЦ n Te(Р3дY-АР pU-ЄЦ  Cry(Р3јY-АР pU-ЄЦ llip(Р3Z-АР pU-ЄЦ natu(Р3@Z-АР pU-ЄЦ MЩ(Р3dZ-АР pU-ЄЦ 07)E(Р3ˆZ-АР pU-ЄЦ  Sec(Р3ЌZ-АР pU-ЄЦ  Tec0[-H[-(Р3аZ-АР pU-ЄЦ  - P(Р3єZ-АР pU-ЄЦ БI(Р3[-АР pU-ЄЦ 2.2 8[1иb-H[-([-ЭЬйoР[1xc-0[-@[-ЭЬйoьч57p[-t 2-иb-xc-ШО а[-Œ[-Ш\-ј]-afety of InfH† (Р3CAN/07)EngmX[-tionьч57(\-ty Tиb-xc-ШО ˆ\-D\-`]-^-vices to SupaH† (Р3@-№_-\-FrenШО  ]-formation - Teches dxv (Р3onfi88 !charge8[1jicationШО И]-6a”ДI (R2xv (Р30Ide88 atless 8[1bd CircuШО P^-ards - Part 3: A”Еxv (Р388 5776:04Р[1Bnglish1ШО ш^-n6a”8xv (Р310In88 Р[1r SemantP‘ (Р3ve Thhuional `ts ШО (_-t_-(РгРРгonЌm гН Љxv (Р3eІ88  А э U иb-( ѓCƒ`;=<Р8>љ1‘PU0˜Ед3Р 8 CREATE PROCEDURE dbo.sp_renamediagram ( @diagramname sysname, @owner_id int = null, @new_diagramname sysname ) WITH EXECUTE AS 'dbo' AS BEGIN set nocount on declare @theId int declare @IsDbo int declare @UIDFound int declare @DiagId int declare @DiagIdTarg int declare @u_name sysname if((@diagramname is null) or (@new_diagramname is null)) begin RAISERROR ('Invalid value', 16, 1); return -1 end EXECUTE AS CALLER; select @theId = DATABASE_PRINCIPAL_ID(); select @IsDbo = IS_MEMBER(N'db_owner'); if(@owner_id is null) select @owner_id = @theId; REVERT; select @u_name = USER_NAME(@owner_id) select @DiagId = diagram_id, @UIDFound = principal_id from dbo.sysdiagrams where principal_id = @owner_id and name = @diagramname if(@DiagId IS NULL or (@IsDbo = 0 and @UIDFound <>!@theId)) begin RAISERROR ('Diagram does not exist or you do not have permission.', 16, 1) return -3 end -- if((@u_name is not null) and (@new_diagramname = @diagramname)) -- nothing will change -- return 0; if(@u_name is null) select @DiagIdTarg = diagram_id from dbo.sysdiagrams where principal_id = @theId and name = @new_diagramname else select @DiagIdTarg = diagram_id from dbo.sysdiagrams where principal_id = @owner_id and name = @new_diagramname if((@DiagIdTarg is not null) and @DiagId <> @DiagIdTarg) begin RAISERROR ('The name is already used.', 16, 1); return -2 end if(@u_name is null) update dbo.sysdiagrams set [name] = @new_diagramname, principal_id = @theId where diagram_id = @DiagId else update dbo.sysdiagrams set [name] = @new_diagramname where diagram_id = @DiagId return 0 END 0бйШ4Р =8 CREATE PROCEDURE dbo.sp_alterdiagram ( @diagramname sysname, @owner_id int = null, @versiom int, @definition varbinary(max) ) WITH EXECUTE AS 'dbo' AS BEGIN set nocount on declare @theId int declare @retval int declare @IsDbo int declare @UIDFound int declare @DiagId int declare @ShouldChangeUID int if(@diagramname is null) begin RAISERROR ('Invalid ARG', 16, 1) return -1 end execute as caller; select @theId = DATABASE_PRINCIPAL_ID(); select @IsDbo = IS_MEMBER(N'db_owner'); if(@owner_id is null) select!@owner_id = @theId; revert; select @ShouldChangeUID = 0 select @DiagId = diagram_id, @UIDFound = principal_id from dbo.sysdiagrams where principal_id = @owner_id and name = @diagramname if(@DiagId IS NULL or (@IsDbo = 0 and @theId <> @UIDFound)) begin RAISERROR ('Diagram does not exist or you do not have permission.', 16, 1); return -3 end if(@IsDbo <> 0) begin if(@UIDFound is null or USER_NAME(@UIDFound) is null) -- invalid principal_id begin select AShouldChangeUID = 1 ; end end -- update dds data update dbo.sysdiagrams set definition = @definition where diagram_id = @DiagId ; -- change owner if(@ShouldChangeUID = 1) update dbo.sysdiagrams set principal_id = @theId where diagram_id = @DiagId ; -- update dds version if(@version is not null) update dbo.sysdiagrams set version = @version where diagram_id = @DiagId ; return 0 END 0 ўМ5Р Ш8 CREATE PROCEDURE dbo.sp_dropdiagram ( @diagramname sysname, @owner_id int = null ) WITH EXECUTE AS 'dbo' AS BEGIN set nocount on declare @theId int declare @IsDbo int declare @UIDFound int declare @DiagId int if(@diagramname is null) begin RAISERROR ('Invalid value', 16, 1); return -1 end EXECUTE AS CALLER; select @theId = DATABASE_PRINCIPAL_ID(); select @IsDbo = IS_MEMBER(N'db_owner'); if(@owner_id is null) select @owner_id = @theId; REVERT; select @DiagId = diagram_id, @UIDFound = principal_id from dbo.sysdiagrams where principal_id = @owner_id and name = @diagramname if(@DiagId IS NULL or (@IsDbo = 0 and @UIDFound <> @theId)) begin RAISERROR ('Diagram does not exist or you do not have permission.', 16, 1) return -3 end delete from dbo.sysdiagrams where diagram_id = @DiagId; return 0; END 0C"Б6Р Н8 CREATE FUNCTION dbo.fn_diagramobjects() RETURNS int WITH EXECUTE AS N'dbo' AS BEGIN declare @id_upgraddiagrams int declare @id_sysdiagrams int declare @id_helpdiagrams int declare @id_helpdiagramdefinition int declare @id_creatediagram int declare @id_renamediagram int declare @id_alterdiagram int declare @id_dropdiagram int declare @InstalledObjects int select @InstalledObjects = 0 select @id_upgraddiagrams = object_id(N'dbo.sp_upgraddiagrams'), @id_sysdiagrams = object_id(N'dbo.sysdiagrams'), @id_helpdiagrams = object_id(N'dbo.sp_helpdiagrams'), @id_helpdiagramdefinition = object_id(N'dbo.sp_helpdiagramdefinition'), @id_creatediagram = object_id(N'dbo.sp_creatediagram'), @id_renamediagram = object_id(N'dbo.sp_renamediagram'), @id_alterdiagram = object_id(N'dbo.sp_alterdiagram'), @id_dropdiagram = object_id(N'dbo.sp_dropdiagram') if @id_upgraddiagrams is not null select @InstalledObjects = @InstalledObjects + 1 if @id_sysdiagrams is not null select @InstalledObjects = @InstalledObjects + 2 if @id_helpdiagrams is not null select @InstalledObjects = @InstalledObjects + 4 if @id_helpdiagramdefinition is not null select @InstalledObjects = @InstalledObjects + 8 if @id_creatediagram is not null select @InstalledObjects = @InstalledObjects + 16 if @id_renamediagram is not null select @InstalledObjects = @InstalledObjects + 32 if @id_alterdiagram is not null select @InstalledObjects = @InstalledObjects + 64 if @id_dropdiagram is not null select @InstalledObjects = @InstalledObjects + 128 return @InstalledObjects END 6h8ї 8їЈ8ї (@ЉStandardsDB_repl 6ˆ((іі(хdbostatus_codesЌА(ііџџџџџџџџpЎ6Џ69ї(@Љ:ї№:їр;їа<їР=їЈ>ї(@їЈ 89їЌА(ііџџџџџџџџ˜Ÿ6РŸ6status_idhщ6 ш9їџџџџxQј№6XаіAЇЇ а4 ЇЇ а4 ЇЇ а4ЌА(ііџџџџџџџџ˜Ÿ6РŸ6status_enghщ6 и:їџџџџ0Qј№6XаіAЇЇ2а42ЇЇ2а42ЇЇ2а4ЌА(ііџџџџџџџџ˜Ÿ6РŸ6status_frehщ6 Ш;їџџџџ№6XаіЇЇ2а42ЇЇ2а42ЇЇ2а4ЌА(ііџџџџџџџџ˜Ÿ6РŸ6create_datehщ6 И<їџџџџ№6Xаі======ЌА(ііџџџџџџџџ˜Ÿ6РŸ6update_datehщ6 Ј=їџџџџ№6Xаі======ЌА(ііџџџџџџџџ˜Ÿ6РŸ6user_idhщ6 ˜>їџџџџ№6Xаі88 88 88 ЌА(ііџџџџџџџџ˜Ÿ6РŸ6active{Г v`9 <Ž |? 00<, $ŸТ§ќŽš€?€@€?€@€?€?0<, $ŸЦ§ќŽš€?€@€?€@€?€?0<.@"0<."0<."0<."0<1$œ а№Г=› €?9Žу=9Žу=9Žу=’BA€?€@€@€BA€?0<1 @$: д№Г=› €?9Žу=€@A€@К0G^uŒЃ€?€? И'-€?€?Bм.€?€?эHј0€?€?€?_‘р2€?€?€?бйШ4€?€?€?C"Б60<1 @$Ÿ й№Г=› €?€@A€@A€?0<1 @"0<2$ХЊцqš&Д=€@иA€@Eия4KbyЇОеь1H_vЄЛвщ.€?€?"€?€?#€?€?$€?€?0€?€?4€?€?8€?€?:€?€?;€?€?<€?€?=€?€?>€?€?b€?€?c€?€?h€?€?j€?€?l€?€?z€?€?€?€?Ѕ€?€?Ї€?€?­€=€?Џ€?€?Н€?€?ч€?€?я€?€?ё€?€?0<2$Ÿ†Њцqš€?&Д=&Д=0Ё­AиA€@_B[A€@иA€?0<1 @$[ о№Г=› €?€BA€B_г0A€?Wmicrosoft_database_tools_supportџ (( microsoft_database_tools_support@ ќЅиSC06; ЌиВи&еџџџџр еа4!е јВи ШО PГи ГиPІиЈž @Ри˜Ви Ги Ги( ијВиsysРГишГиаз6ЈГишГиsysxpropsџџяаГиsyssysxprops syssysxpropsREADUNCOMMITTED@№Пџџџџ@№Пџџџџ@ ШB№ПџџџџSAMPLE ШB№Пџџџџ<68Еи@ЕиHМи( иЄЦ syssysxpropsl(е№%еф'еx(еS I‹цqšк№Г=›I‹цqš1I‹цqšhМи()еPЖи( иЈДи 4е„Р /Xе( иР.е№/е@Wе`0ер0еPfишfиXЕи1 ˜е˜?е Р?еаИи( ифЌ~Sеxе@Cе(CеCејBерерBеШBеМ)еˆCе€Kе”Р ( ирИи( ии[ешИи( ирЌ~HAеЕиШ)е1еШМиј)еџџџџџџџџџџџџ(Ми( и8Ми( и/еpKеxе8( иќИиАР рЌ~ЄЦ ( и ЙиАР рЌ~ЄЦ ( иDЙиАР рЌ~ЄЦ ( иhЙиАР рЌ~ЄЦ ( иŒЙиАР рЌ~ЄЦ ( иАЙиАР рЌ~ЄЦ ( идЙиАР рЌ~ЄЦ 8( ијЙиАР рЌ~ЄЦ ( иКиАР рЌ~ЄЦ ( и@КиАР рЌ~ЄЦ ( иdКиАР рЌ~ЄЦ HКи( иˆКиАР рЌ~ЄЦ ( иЌКиАР рЌ~ЄЦ ( иаКиАР рЌ~ЄЦ ( иєКиАР рЌ~ЄЦ №­и( иЛиАР рЌ~ЄЦ ( и<ЛиАР рЌ~ЄЦ ( и`ЛиАР рЌ~ЄЦ ( и„ЛиАР рЌ~ЄЦ ( иЈЛиАР рЌ~ЄЦ ( иЬЛиАР рЌ~ЄЦ ( и№ЛиАР рЌ~ЄЦ ( иМиАР рЌ~ЄЦ syssysxpropssyssysxprops р=;( иPЖи(R ( и еШО А[емМиИе8Ни8Ни( иШМиPAC( иШО @НиdНиШМиР#еSC0ЄІиАНиАНишНи( ид№Ни„м ˜Вииk ( иШО ОиDОишОирИи6; ЈНи|џџџџа4шОиШО @ПиќОи€6еЈž ( иˆОииk @РиШО xПиМПијВиЬб Pуи‚Н !ќТ&тРžџ`џD˜йe!@щH9Я‡?TUќM7Iƒ hF)4€E)4bzE)4ˆE)4F)4pE)4‰VќMedical devices Quality management systems Guidance on the application of ISO 13485:2003-First Edition; ISO/TR 14969:2004TVќ{@8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3pEА3WќMedical devices Quality management systems Requirements for regulatory purposes-Second Edition; ISO 13485: 1996TWќq@8E4E hF4bpE4€E4ˆE4F4pE4TXќ4Steel Tubing for Engine Air/Fluid Systems-Revision RTYќ:CONTROL OF HEAT TREATING PROCESSES AND AUXILIARY EQUIPMENTЦZќStandard Test Method for Determining the Rate of Air Leakage Through Exterior Windows, Curtain Walls, and Doors under Specified Pressure and Temperature Differences Across the SpecimenTZќИ@8E4E hE4bpE4€E4ˆE4F4pE4pE4V[ќNAS Certification & Qualification of Nondestructive Test Personnel-REV 3T[ќH@ 8EL3E hFL3bpEL3€EL3ˆEL3FL3pEL3T\ќ@Paints and Varnishes - Pull-Off Test for Adhesion-Second EditionT]ќ7Quality Management Systems - Requirements-Third EditionT^ќ7Quality Management Systems - Requirements-Third EditionЕ_ќGreenhouse gases Part 1: Specificatimn with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-First EditionT_ќЇ@8EL3E hFL3bpEL3€EL3ˆEL3FL3pEL3pEL3б`ќGreenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhancements-First EditionT`ќУ@8EL3E hFL3bpEL3€EL3ˆEL3FL3pEL3pEL3’aќGreenhouse gases Part 3: Specification with guidance for the validation and verification of greenhouse gas assertions-First EditionTaќ„@8E4E hF4bpE4€E4ˆE4F4pE4rbќPaper and board — Determination of grease resistance — Part 2: Surface repellency test-First EditionTbќd@8Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3wcќSoft Soldering Fluxes - Test Methods - Part 16: Flux Efficacy Tests, Wettine Balance Method-First EditionTcќi@8Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3vdќSoft Soldering Fluxes - Test Methods - Part 10: Flux Efficancy Tests, Solder Spread Method-First EditionTdќh@8E!4E hF!4bpE!4€E!4ˆE!4F!4pE!4heќSoftware engineering — Process assessment — Part 2: Performing an assessment-First EditionTeќZ@8EХ3E hFХ3bpEХ3€EХ3ˆEХ3FХ3pEХ3Tfќ7Quality Management Systems - Requirements-Third Edition˜gќAERONAUTICAL TELECOMMUNICATIONS Volume IV Surveillance Radar and Collision Avoidance Systems-Fourth Edition; Incorporates Amendments 70-82TgќŠ@8EКLE hFКLbpEКL€EКLˆEКLFКLpEКLThќ7Quality Management Systems - Requirements-Third Edition}iќQuality Management Systems - Guidelines for Performance Improvements-Second Edition; Supersedes ISO 9014-1:1994Tiќo@ 8EКLE hFКLbpEКL€EКLˆEКLFКLpEКLpEКLЬjќMeasurement of water flow in fully charged closed conduits - Meters for cold potable water and hot water - Part 1: Specifications-Third Edition; Replaces ISO 7858-1:1998 and ISO 10385-1:2000TjќО@"8EL3E hFL3bpEL3€EL3ˆEL3FL3pEL3УkќMeasurement of water flow in fully charged closed conduits - Meters for cold potable water and hot water - Part 3: Teqt methods and equipment-Third Edition; Replaces ISO 7858-3:1992TkќЕ@$8E4E hF4bpE4€E4ˆE4F4pE4VlќNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TlќH@&8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3mќCOMMISSION REGULATION amending Annexes VI and VIII to Regulation (EC) No 1774/2002 of the European Parliament and of the Council as regards processing standards for biogas and compmsting plants and requirements for manure-Text with EEA relevanceTmќѕ@(8EЫLE hFЫLbpEЫL€EЫLˆEЫLFЫLpEЫLnќCOMMISSION REGULATION amending Annexes VI and VIII to Regulation (EC) No 1774/2002 of the European Parliament and of the Council as regards processing standards for biogas and composting plants and requirements for manure-Text with EEA relevanceTnќѕ@*8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3oќMethodes Pour Epreuves Textiles Essai De Resistance A L'Inflammation Sous Un Angle De 45 Degrees - Application De La Flamme Pendant Une SecondeToќ@,8En3E hFn3bpEn3€En3ˆEn3Fn3pEn3`pќInformation and Documentation - Records Management - Part 1: General-First EditionTpќR@.8EL3E hFL3bpEL3€EL3ˆEL3FL3pEL3xqќRecords Management Part 2: Guidelines-ISO 15489.2: 2002; Supersedes in Part AS 4390.1 Thru AS 4391.6: 1996Tqќj@08En3E hFn3bpEn3€En3ˆEn3Fn3pEn3pEn3TY9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11T) 3BOCA National Building Code/1996 Thirteenth EditionT* 3BOCA National Building Code/1996 Thirteenth Editiony+ Technical Drawings - Construction Drawings - Representation of Modular Sizes, Lines and Grids First EditionT+ k@58EF3E hFE3bpEF3€EF3ˆEF3FF3pEF3і, Suitability of Non-Metallic Products for Use in Contact with Water Intended for Human Consumption with Regard to Their Effect on the Quality of the Water - Part 1: Specification-AMD 14717: January 21, 2004; AMD 15475: March 31, 2005T, ш@78EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯf- Qualification Requirements for Elastomer Diaphragms for Nuclear Service Diaphragm ValvesT- X@98En3E hFn3bpEn3€En3ˆEn3Fn3pEn3. Project 25 Trunking Control Channel Formats – New Technology Standards Projects – Digital Radio Technical StandardsT. s@;8EjE hFjbpEj€EjˆEjFjpEjІ/ General Tolerances - Part 1: Tolerances for Linear and Angular Dimensions without Individual Tolerance Indications First Edition; (CEN EN 22768-1: 1993)T/ ˜@=8EjE hFjbpEj€EjˆEjFjpEjpEjq0 Trunking Control Channel Messages Addendum for ISSI Supplementary Data-Addendum 3 to TIA-102.AABC-BT0 c@?8EjE hFjbpEj€EjˆEjFjpEjpEj1 Information technology - Security techniques - Information security management systems - Requirements-First EditionT1 s@A8En3E hFn3bpEn3€En3ˆEn3Fn3pEn3pEn32 2 Information technology - Security techniques - Information security management syqtems - Requirements-First EditionFjpEjpEj1 1 Information technology - Security techniques - Information security management systems - Requirements-First EditionT1 s@A8En3E hFn3bpEn3€En3ˆEn3Fn3pEn3pEn3діЯАіЯиіЯШіЯфіЯx§Яh(€Т0 >НiјЄўЊ)еo%бXА\<мˆы—”@=щ“?|(\‹ 7 у K ї Ѓ ; ч q  І R рŒњІеЬx$а|&в Иd‘=Д`џL˜йцAь˜>єнT2 s@Cƒ hFЯ€EЯbzEЯˆEЯFЯpEЯ3 Information technology — Security techniques — Code of practice for information security management-First EditionT3 qA8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯpEЯ4 Information technology — Security techniques — Code of practice for information security management-First EditionT4 qA8EфLE hFфLbpEфL€EфLˆEфLFфLpEфL5 Information technology - Security techniques - Information security management systems - Requirements-First EditionT5 sA8En3E hFn3bpEn3€En3ˆEn3Fn3pEn3pEn36 Information technology - Security techniques - Information security management systems - Requirements-First EditionT6 sA8En3E hFn3bpEn3€En3ˆEn3Fn3pEn3pEn27 Information technology — Security techniques — Code of practice for information security management-First EditionT7 qA 8EьLE hFьLbpEьL€EьLˆEьLFьLpEьL8 Information technology — Security techniques — Code of practice for information security management-First EditionT8 qA 8EфLE hFфLbpEфL€EфLˆEфLFфLpEфLpEфL9 Information technology — Security techniques — Code of practice for infnrmation security management-First EditionT9 qA 8EќLE hFќLbpEќL€EќLˆEќLFќLpEќL: Information technology - Security techniques - Information security management systems - Requirements-First EditionT: sA8EќLE hFќLbpEќL€EќLˆEќLFќLpEќLpEќLo; Recyclability/Recoverability Guidelines-Revision D; Replaces EDS-M-0103, GM502M, and TKLE-97-0097T; aA8EќLE hFќLbpEќL€EќLˆEўLFќLpEќLpEќLTљ7Quality Management Systems - Requirements-Third EditionŸњMedical devices - Application of risk management to medical devices (ISO 14971:2007) Corrigendum 1 to English version of DIN EN ISO 14971:2007-07Tњ‘A8EзE hFзbpEз€EзˆEзFзpEзŸћMedical devices - Application of risk management to medical devices (ISO 14971:2007) Corrigendum 1 to English version of DIN EN ISO 14971:2007-07Tћ‘A8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯXќStandard Specification for Plain and Laminated Elastomeric Bridge BearingsTќJA8EпE hFпbpEп€EпˆEпFпpEп~§Software engineering - Guidelines for the application of ISO 9001:2000 to computer software (ISO/IEC 90003:2004)T§pA8EљE hFљbpEљ€EљˆEљFљpEљOўStandard Test Methods for Rockwell Hbrdness of Metallic MaterialsTўAA8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧTџ?Standard Test Method for Microindentation Hardness of MaterialssStandard Practice for Conducting an Interlaboratory Study to Determine the Precision of a Test MethodTeA8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3T7Quality Management Systems - Requirements-Third EditionT7Quality Manafement Systems - Requirements-Third EditionT7Quality Management Systems - Requirements-Third EditionT7Quality Management Systems - Requirements-Third EditionfStainless steel needle tubing for manufacture of medical devices-(AMENDS DS/EN ISO 9626)TXA%8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3sStandard Practice for Conducting an Interlaboratory Study to Determine the Precision of a Tert MethodTeA'8Ew3E hFw3bpEw3€Ew3ˆEw3Fw3pEw3TBridge Welding Code`Power-Operated Dispensing Devices for Flammable Liquids-General Instruction No 1-2TRA*8EзE hFзbpEз€EзˆEзFзpEзT Bridge Welding Codey Electrical Equipment for Flammable and Combustible Fuel Djspensers-General Instruction No 1; Fourth EditionT kA-8EзE hFзbpEз€EзˆEзFзpEзpEзz Hypodermic Needles for Single Use - Colour Coding for Identification ; (CEN EN ISO 6009: 1994)-Third EditionT lA/8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧe Stainless Steel Needle Tubing for Manufacture of Medical Devices-Amendment 1:06/01/2001T WA18E_3E hF_3bpE_3€E_3ˆE_3F_2pE_3TЩ0INSTALLATION OF FIRE ALARM SYSTEMS-Fifth EditionTЪ0INSTALLATION OF FIRE ALARM SYSTEMS-Fifth EditionfЫEnvironmental management Life cycle assessment Principles and framework-Second EditionTЫXA58EяE hFяbpEя€EяˆEяFяpEяhЬEnvironmental management Life cycle assessment Requirements and guidelines-First EditionTЬZA78EяE hFяbpEя€EяˆEяFяpEяpEяTЭ<Financial services — Privacy impact assessment-First EditionYЮSafety of Machinery - Emergency Stop - Principles for Design-Second EditionTЮKA:8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3pEУ3žЯReciprocating internal combustion engine driven alternating current generating sets Part 1: Application, ratings and performance-Second EditionTЯA<8EУ3E hFУ3bpEТ3€EУ3ˆEУ3FУ3pEУ3pEУ3аThe ISO 14971:2007 essentials — A practical handbook for implementing the ISO 14971 Standard for medical devices-Second EditionTаA>8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3pEУ3бThe ISO 14971:2007 essentials — A practical handbook for implementing the ISO 14971 Standard for medical devices-Second EditionTбA@8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3ˆвAcoustics - Determjnation of Occupational Noise Exposure and Estimation of Noise-Induced Hearing Impairment-Second EditionTвzAB8EПE hFПbpEП€EПˆEПFПpEПˆгAcoustics - Determination of Occupational Noise Exposure and Estimation of Noise-Induced Hearing Impairment-Second EditionTгzAD8EkE hFkbpEk€EkˆEkFkpEkRдMatting, Floor, Rubber or Plastic, Standard for-Amendment 1 May 1981TдDAF8EзE hFзbpEз€EзˆEзFзpEзTе6Standard Specification for Stainless Steel Spring WireˆжAcoustics - Determination of Occupational Noise Exposure and Estimation of Noise-Induced Hearing Impairment-Second EditionTжzAI8EчE hFчbpEч€EчˆEчFчpEчpEчзkзSafety of Machinery - Minimum Gaps to Avoid Crushing of Parts of the Human Body-First Edition6Standard Srecification for Stainless Steel Spring WireжˆжAcoustics - Determination of Occupational Noise Exposure and Estimation of Noise-Induced Hearing Impairment-Second EditionTжzAI8EчE hFчbpEч€EчˆEчFчpEчpEч{‘=щ—CЛgп‹ўЊЩ+з~*жnД` ИSџ…1ИdА\•Aл‡3п ‹ 7 Ф p  Э y ћ Ї O ћ \  iСRў})ЊVзƒА/лZ‡3Д`џL˜й#SBюК‰rTз]AKƒ hF_3€E_3bzE_3ˆE_3F_3pE_3”иSafety of Machinery - Positioning of Protective Equipment with Respect to the Approach Speeds of Parts of the Human Body-First EditionTи†B8EяE hFяbpEя€EяˆEяFяpEяйSafety of machinery — Safety distances to prevent hazard zones being reached by upper and lower limbs-First EditionTйsB8EяE hFяbpEя€EяˆEяFяpEяpEяTкNational Electrical Safety CodePлControl of Hazardous Energy Lockout/Tagout and Alternative MethodsTлBB8E%4E hF%4bpE%4€E%4ˆE%4F%4pE%4Tм&National Electrical Code -2008 Edition€нInsert, Screw Thread, Helical Coil, Inch Series, Coaqse and Fine Thread, Standard Assembly Dimensions for-FSC 5340TнrB 8EчE hFчbpEч€EчˆEчFчpEч…оRestricted and Reportable Substances for Parts-English; Revision I; Replaces HN 1000, GM1000M, EDS-A-0101 and STD 3977.TоwB 8EH4E hFH4bpEH4€EH4ˆEH4FH4pEH4€пInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340TпrB 8EчE hFчbpEч€EчˆEчFчpEч€рInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340TрrB8E%4E hF%4bpE%4€E%4ˆE%4F%4pE%4Tс9INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-Edition 11wтCosmetics — Good Manufacturing Practices (GMP) — Guidelines on Good Manufacturing Practices-First EditionTтiB8E-4E hF-4bpE-4€E-4ˆE-4F-4pE-4Tу<Financial services — Privacy impact assessment-First EditionwфCosmetics — Good Manufacturing Practices (GMP) — Guidelines on Good Manufacturing Practices-First EditionTфiB8EH4E hFH4bpEH4€EH4ˆEH4FH4pEH4wхCosmetics — Good Manufacturing Practices (GMP) — Guidelines on Good Manufacturing Practices-First EditionTхiB8E 4E hF 4bpE 4E 4ˆE 4F 4pE 4pE 4Tц0Standard Practice for Application of Hose StreamuчGENERAL REQUIREMENTS FOR BODIES OPERATING PRODUCT CERTIFICATION SYSTEMS-Same as ISO/IEC Guide 65 : 1996TчgB8E4E hF4bpE4€E4ˆE4F4pE4VшNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TшHB8EG3E hFG3bpEG3€EG3ˆEG3FG3pEG3VщInformation tecinology equipment – Safety – Part 1: General requirementsTщHB8EYLE hFYLbpEYL€EYLˆEYLFYLpEYLnъSafe Welding, Cutting, and Other Hot Work Practices in the Petroleum and Petochemical IndustriesTъ`B 8EYLE hFYLbpEYL€EYLˆEYLFYLpEYLpEYLTы1Emergency Preparedness and Response-Third EditionаьGeneral Specification for Electrical/Electronic Component Analytical/Developmenu/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance RequirementsTьТB#8EYLE hFYLbpEYL€EYLˆEYLFYLpEYLаэGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance RequirementsTэТB%8EYLE hFYLbpEYL€EYLˆEYLFYLpEYLpEYLTю@Suandard Guide for Selection and Use of Flat Strapping Materials}яStandard Test Method for Steady-State Thermal Transmission Properties by Means of the Heat Flow Meter ApparatusTяoB(8E14E hF14bpE14€E14ˆE14F14pE14T№7CHROMIUM PLATING, LOW EMBRITTLEMENT, ELECTRO-DEPOSITIONlёGeneral requirements for the competence of testing and calibration laboratories-Second editionTё^B+8E_3E hF_3apE_3€E_3ˆE_3F_3pE_3„ђCharacterization of waste — Halogen and sulfur content — Oxygen combustion in closed systems and determination methodsTђvB-8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3]ѓMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TѓOB/8Eu3E hFu3bpEu3€Eu3ˆEu3Fu3pEu3Tє*Electronic Records as Documentary Evidence“aѕEnvironmental management systems Requirements with guidance for use-Second EditionTѕSB28Eu3E hFu3bpEu3€Eu3ˆEu3Fu3pEu3‚$aіEnvironmental management systems Requirements with guidance for use-Second EditionTіSB48EkE hFkbpEk€EkˆEkFkpEkїVentilation and Acceptable Indoor Air Quality in Low-Rise Residential Buildings-Includes ANSI/ASHRAE addenda listed in Appendix CTѕB68EПE hFПbpEП€EПˆEПFПpEПnјMedical devices Quality management systems Requirements for regulatory purposes-Second EditionTј`B88Eё3E hFё3bpEё3€Eё3ˆEё3Fё3pEё3Tљ"Measuring Air-Change Effectiveness>@Tњ7Quality Management Systems - Requirements-Third EditionTћ7Quality Management Systems - Requirements-Third Edition™ќInformation technology Learning, education and training Quality management, assurance and metrics Part 1: General approach-First EditionTќ‹B=8E 4E hF 4bpE 4€E 4ˆE 4F 4pE 4T§4Basic environmental testing procedures-Third EditionTў;Crimped Joints for Aircraft Electrical Cables-First EditionTџ3Symbols for use in the labelling of medical devices’Standard Test Method for Evaluation of Crimped Electrical Connections to 16-Gauge and Smaller Diameter Stranded and Solid ConductorsT„BB8EA4E hFA4bpEA4€EA4ˆEA4FA4pEA4ƒUL Standard for Safety for Wire Connectors-First Edition; Reprint with Revisions Through and Including August 25,2006TuBD8EПE hFПbpEП€EПˆEПFПpEПuStandard Specification for Standard Atmospheres for Conditioning!and Testing Flexible Barrier MaterialsTgBF8E 4E hF 4bpE 4€E 4ˆE 4F 4pE 4pE 4TECG cables and leadwires€?РCCЫ€?сЕ€?†@ЃCoZ€?ПЗjAmendment 1 to ANSI/AAMI EC53: 1995, American National Standard for ECG cables and leadwiresT\BI8EПE hFПbpEП€EПˆEПFПpEПpEПЙPetroleum, petrochemical and natural gas industries — Sector-specific quality managemenu systems — Requirements for product and service supply organizations-Second EditionjAmendment 1 to ANSI/AAMI EC53: 1995, American National Standard for ECG cables and leadwiresT\BI8EПE hFПbpEП€EПˆEПFПpEПpEП( ЄЦ ЇЇ@а4У  tа šШО š8Юz&Б]к†є LјЄ ЗcЛMљjЕaЌXћЇ#ЯcЛ>ъ–ЦrЂ N њ Œ 8 т Ž 8 ф o  Ч P ќ…1нfО>ъj‘=НiХqœHД`џP˜йŽрC№с1TЋBKƒ hFA4€EA4bzEA4ˆEA4FA4pEA4pEA4T>Standard Test Method for Needle Penetration of Petroleum WaxesZStandard Test Method for ASTM Color of Petroleum Products (ASTM Color Scale)TLC8EkE hFkbpEk€EkˆEkFkpEkZStandard Test Method for ASTM Color of Petroleum Products (ASTM Color Scale)TLC8EщE hFщbpEщ€EщˆEщFщpEщpEщZ Standard Test Method for ASTM Color of Petroleum Products (ASTM Color Scale)T LC8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3Z Standard Test Method for ASTM Color of Petroleum Products (ASTM Color Scale)T LC8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3pEg3T >Standard Test Method for Needle Penetration!of Petroleum Waxes€ Safety of machinery Safety-related parts of control systems Part 1: General principles for design-Second EditionT rC 8E4E hF4bpE4€E4ˆE4F4pE4€ Safety of machinery Safety-related parts of control systems Part 1: General principles for design-Second EditionT rC 8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3€Safety of machinery Safety-related parts of control qystems Part 1: General principles for design-Second EditionTrC8EkE hFkbpEk€EkˆEkFkpEk€Safety of machinery Safety-related parts of control systems Part 1: General principles for design-Second EditionTrC8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3€Safety of machinery Safety-related parts of control systems Part 1: General principles for design-Second EditionTrC8E4E hF4bpE4€E4ˆE4F4pE4pE4€Insert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340TrC8Eu3E hFu3bpEu3€Eu3ˆEu3Fu3pEu3T7Quality Management Systems - Requirements-Third EditionT@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176T@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176T@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176OStandard for Spur, Helical, Herringbone and Bevel Enclosed DrivesTAC8ET3E hFT3bpET3€ET3ˆET3FT3pET3pET3МConformity assessment Requirements for bodies providing audit and certification of management systems-First Edition; Replaces ISO/IEC Guide 62:1996 and ISO/IEC Guide 66:1999TЎC8ET3E hFT3bpET3€ET3ˆET3FT3pET3Дс3SStandard Specification for Copper Sheet, Strip, Plate, and Rolled BarTEC8Eu3E hFu3bpEu3€Eu3ˆEu3Fu3pEu3g{lGeneral requirements for the competence of testing and calibration laboratories-Second editionT^C!8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3lGeneral requirements for the competence of testing and calibration laboratories-Second editionT^C#8EщE hFщbpEщ€EщˆEщFщpEщT>Standard Test Method for Needle Penetration of Petroleum Waxes†BuStandard Specification for Standard Atmospheres for Conditioning and Testing Flexible Barrier MaterialsTgC&8E!4E hF!4bpE!4€E!4ˆE!4F!4pE!4T8Standard Specification for Stainless Steel Needle Tubing€?HBT1Dimensional Tolerances for Aluminum Mill Products€?ϘЖvyGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TkC*8EПE hFПbpEП€EПˆEПFПpEПT  Shoe PolishT!MasterFormat 2004 Editiona™"Alloy and Temper Designation Systems for Aluminum-Replaces H35.1 and H35.1(M): 2004T™"SC.8EИ3E hFЙ3bpEИ3€EИ3ˆEИ3FИ3pEИ3`EИ3aš"Alloy and Temper Designation Systems for Aluminum-Replaces H35.1 and H35.1(M): 2004Tš"SC08EПE hFПbpEП€EПˆEПFПpEПV›"Ergonomics Manual handling Part 1: Lifting and carrying-Premiшre щditionT›"HC28EџE hFџbpEџ€EџˆEџFџpEџYœ"Ergonomics — Manual handling — Part 2: Pushing and pulling-Premiшre щditionTœ"KC58EџE hFџbpEџ€EџˆEџFџpEџpEџm"Ergonomics — Manual handling — Part 3: Handling of low loads at high frequency-Premiшre щditionT"_C68E4E hF4bpE4€E4ˆE4F4pE4Yž"Ergonomics — Manual handling — Part 2: Pushing and pulling-Premiшre щditionTž"KC88EkE hFkbpEk€EkˆEkFkpEkmŸ"Ergonomics — Manual handling — Part 3: Handling of low loads at high frequency-Premiшre щditionTŸ"_C:8EkE hFkbpEk€EkˆEkFkpEkpEkT "4Standard No. 302; Flammability of interior materials*m ˆяTЁ"4Standard No. 302; Flammability of interior materials*m ˆяTЂ"4Standard No. 302; Flammability of interior materialsTЃ"(Design of Below-the-Hook Lifting DeviceslЄ"General requirements for the competence of testing and calibratiom laboratories-Second editionTЄ"^C@8Eu3E hFu3bpEu3€Eu3ˆEu3Fu3pEu3aЅ"Natural gas and propane installation code-Thirteenth Edition; Supplement 1: 01/2007TЅ"SCB8EkE hFkbpEk€EkˆEkFkpEkpEkTІ")Natural gas and propane installation code…Ї"Code for the field approval of fuel-related components on appliances and equipment-Third Edition; Supplement 1: 01/2007TЇ"wCE8EkE hFkbpEk€EkˆEkFkpEkpEk€Ј"Electrical Characteristics of Low Voltage Differential Signaling (LVDS) Interface Circuits-Revision of TIA/EIA-644TЈ"rCG8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3XЉ"Recommended Practice for Electric Power Distribution for Industrial PlantsTЉ"JCI8ET3E hFT3bpET3€ET3ˆET3FT3pET3xЊ"Standard Test Method for Resistance to Short-Time Hydraulic Pressure of Plastic Pipe, Tubing, and FittingsTЊ"jCK8E4E hF4bpE4€E4ˆE4F4pE4‰Ћ"Small craft Marine propulsion reciprocating internal combustion engines Power measurements and declarations-Third EditionTЋ"{CM8EПE hFПbpEП€EПˆEПFПpEПЌ"WЌ"Small Craft - Remote Steering Systems First Edition; (CEN EN 28848: 1993)and FittingsTЊ"jCK8E4E hF4bpE4€E4ˆE4F4pE4Ћ"‰Ћ"Small craft Marine propulsion reciprocating internal combustion engines Power measurements and declarations-Third EditionTЋ"{CM8EПE hFПbpEП€EПˆEПFПpEПћd ‰'žJв~&вRўy%бpА\Д` ŸKђž1н„0к†%бpШtћЇSџŠ6т v " Ж b  Л џ Ћ \  Д ` И8фd<Мhш”РlОdЖbД`џI˜йK1Dђ˜qЭФ1TЌ"ICOƒ hFП€EПbzEПˆEПFПpEПpEПY­"Small craft Electrically operated directcurrent bilge pumps-Second EditionT­"KD8EПE hFПbpEП€EПˆEПFПpEПpEПbЎ"Small Craft - Permanently Installed Fuel Systems and Fixed Fuel Tanks-Second EditionTЎ"TD8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯdЏ"Small Craft - Electrical Systems - Extra-Low-Voltage d.c. Installations-Second EditionTЏ"VD8E4E hF4bpE4€E4ˆE4F4pE4pE4TА"6Small Craft - Hydraulic Steering Systems First EditiongБ"Small Craft - Ventilation of Petrol Engine and/or Petrol Tank Compartments-Second EditionTБ"YD8EПE hFПbpEП€EПˆEПFПpEПpEП[В"Small craft Remote!steering systems for inboard mini jet boats-First EditionTВ"MD 8EПE hFПbpEП€EПˆEПFПpEПpEПšГ"Plastics piping and ducting systems – Thermoplastics shafts or risers for inspection chambers and manholes – Determination of ring stiffnessTГ"ŒD 8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯЎД"Plastics piping systems – Thermoplastics shafts or risers for inspection chambers and manholes – Determination of resiqtance against surface and traffic loadingTД" D8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯpEЯhЕ"Thermoplastics inspection chamber and manhole bases – Test methods for buckling resistanceTЕ"ZD8E)4E hF)4bpE)4€E)4ˆE)4F)4pE)4ІЖ"Small Craft - Stability and Buoyancy Assessment and Categorization - Part 1: Non-Sailing Boats of Hull Length Greater than or Equal to 6 m-First EditionTЖ"˜D8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯTЗ"3Symbols for use in the labelling of medical devicesЈИ"Sandwich Constructions and Core Materials; General Test Methods-FSC 5680; Should Be Used Instead of MIL-STD-401B, Which Was Cancelled on 24 September 1999TИ"šD8Eё3E hFё3bpEё3€Eё3ˆEё3Fё3pEё3€i*Electrical Characteristics of Low Voltage Differential Signaling (LVDS) Interface Circuits-Revision of TIA/EIA-644Ti*rD8E4E hF4bpE4€E4ˆE4F4pE4`E4oj*Finacial transaction card orginated messages - Interchange message specifications (ISO 8583:1993)Tj*aD8EjE hFjbpEj€EjˆEjFjpEjlk*General requirements for the competence of testing and calibration laboratories-Second editionTk*^D8EjE hFjbpEj€EjˆEjFjpEjpEjTl*+Ice Hockey Helmetq-General Instruction No 1Tm*=Graphical Symbols for Use in the Labelling of Medical DevicesYMšn*Electrical equipment for measurement, control and laboratory use – EMC requirements – Part 1: General requirements CORRIGENDUM 1-Edition 1.0Tn*ŒD8EўNE hFўNbpEўN€EўNˆEўNFўNpEўNg{Œo*Electrical equipment for measurement, control and laboratory use – EMC requirements – Part 1: General requirements-Edition 1.0To*~D!8E^NE hF^NbpE^N€E^NˆE^NF^NpE^Nšp*Electrical equipment for measurement, control and laboratory use – EMC requirements – Part 1: General requirements CORRIGENDUM 1-Edition 1.0Tp*ŒD#8E^NE hF^NbpE^N€E^NˆE^NF^NpE^NpE^N,q*Electrical equipment for measurement, control and laboratory use – EMC requirements – Part 2-1: Particular requirements – Test configurations, operational conditions and performanae criteria for sensitive test and measurement equipment for EMC unprotected applications-Edition 1.0;:2002Tq*D%8EоNE hFоNbpEоN€EоNˆEоNFоNpEоNTr*7Quality Management Systems - Requirements-Third Edition™s*Category "O" Three-Point Free-Link Attachment for Hitching Implements to Lawn and Garden Ride-On Tractors-(Withdrawn; Replaced by ISO 9191)Ts*‹D(8EžNE hFžNbpEžN€EžNˆEžNFžNpEžN Tt*7Quality Management Systems - Requirements-Third EditionTu*#INSTRUMENT LANDING SYSTEM MODULATORov*Specification for Fusion Welding for Aerospace Applications-Second Printing- Incorporating ErrataTv*aD,8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3\w*Conformity assessment Impartiality Principles and requirements-First EditionTw*ND.8Ev3E hFv3bpEv3€Ev3ˆEv3Fv3pEv3_x*Conformity assessment Confidentiality Principles and requirements-First EditionTx*QD08EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3fy*Conformity assessment Complaints and appeals Principles and requirements-First EditionTy*XD28E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3iz*Conformity assessment Disclosure of information Principles and requirements-First EditionTz*[D48EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3pEV3T{*Accelerated Corrosion TestT|* Laboratory Cyclic Corrosion Test$ь#–ЛršЃх}*Road Vehicles - Electrical Disturbance by Conduction and Coupling - Part 2: Commercial Vehicles with Nominal 24 V Supply Voltage - Electrical Transient Conduction Along Supply Lines Only First Edition-Second EditionT}*зD88EУ3E hFС3bpEУ3€EУ3ˆEУ3FУ3pEУ3Џ~*Road vehicles — Electrical disturbances from conduction and coupling — Part 2: Electrical transient conduction along supply lines only AMENDMENT 1-Second EditionT~*ЁD:8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3Џ*Road vehicles — Electrical disturbances from conduction and coupling — Part 2: Electrical transient conduction along supply lines only AMENDMENT 1-Second EditionT*ЁD<8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3W€*METHODS FOR HYDROSTATIC TESTING OF COMPRESSED GAS CYLINDERS-Ninth editionT€*ID>8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3pEV3n*Standards for Visual Inspection of High Pressure Aluminum Compressed Gas Cylinders-Fifth EditionT*`D@8EѕE hFѕbpEѕ€EѕˆEѕFѕpEѕ]‚*Standards for Visual Inspection of Steel Compressed Gas Cylinders-TENTH EDITIONT‚*ODB8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3pEV3|ƒ*Guidelines for Visual Inspection and Requalification of Fiber Reinforced High Pressure Cylinders-Fifth EditionTƒ*nDD8EўE hFўbpEў€EўˆEўFўpEўT„*Carbon Dioxide-Sixth Edition…*b…*Standard for Insulated Liquid Carbon Dioxide Systems at Consumer Sites-Sixth EditionT…*TDE8EЬE hFЬbpEЬ€EЬˆEЬFЬpEЬFiber Reinforced High Pressure Cylinders-Fifth EditionTƒ*nDD8EўE hFўbpEў€EўˆEўFўpEўT„*Carbon Dioxide-Sixth EditionиШЈž @ ы АР €wXџЎpўЎшЪПxv @ ы н{ХIѕ˜Dж‚+з(д%бь˜D№‡3ЭyЦjЇSџЋОj>ъPќ p  ‚ . к †  Ц W  ƒ / ‡3п9х}){'9оŠ#Я{Уa Д`џK˜й5CEє’–A S†*Carbon Dioxide Cylinder Filling and Handling Procedures-Third EditionT†*EE8EЬE hFЬbpEЬ€EЬˆEЬFЬpEЬpEЬT‡*2COMPRESSED AIR FOR HUMAN RESPIRATION-Sixth EditionTˆ*-Commodity Specification for Air-Fifth Editiond‰*Filling of Industrial and Medical Nonflammable Compressed Gas Cylinders-Fourth EditionT‰*VE8EЬE hFЬbpEЬ€EЬˆEЬFЬpEЬpEЬlŠ*Suggestions for the Care of High Pressure Air Cylinders for Underwater Breathing-Fifth EditionTŠ*^E8EўE hFўbpEў€EўˆEўFўpEўpEўt‹*Standard for Requalification of DOT-3HT, CTC-3HT, and TC-3HTM Seamless Steel Cylinders-Seventh EditionT‹*fE8EЬE hFЬbpEЬ€EЬˆEЬFЬpEЬpEЬtŒ*Stbndard for Requalification of DOT-3HT, CTC-3HT, and TC-3HTM Seamless Steel Cylinders-Seventh EditionTŒ*fE 8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3t*Standard for Requalification of DOT-3HT, CTC-3HT, and TC-3HTM Seamless Steel Cylinders-Seventh EditionT*fE 8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3tŽ*Standard for Requalification of DOT-3HT, CTC-3HT, and TC-3HTM Seamless Steel Cylinders-Seventh EditionTŽ*fE8EjE hFjbpEj€EjˆEjFjpEjpEjП*Specification for Drilling and Production Hoisting Equipment (PSL 1 and PSL 2)-Fourth Edition; ISO 13535:2000/ ISO 13535 Adoption; Addendum 1: 11/1/2004; Addendum 2: 04/15/2005;T*БE8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3pEV3w92Medical laboratories — Reduction of error through risk management and continual improvement-First EditionT92iE8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3`Ef3М:2Mechanical vibration Evaluation of machine vibration by measurements on rotating shafts Part 5: Machine sets in hydraulic power generating and pumping plants-Second EditionT:2ЎE8EдE hFдbpEд€EдˆEдFдpEдT;2:Standard for Health Care Facilities-Errata 05-1 05/23/2005V<2Quality Management Systems - Guidelines for Quality Plans-Second EditionT<2HE8EдE hFдbpEд€EдˆEдFдpEдpEдŠ=2Gully tops and manhole tops for vehicular and pedestrian areas - Design requirements, type testing, marking, quality controlT=2|E8EіE hFіbpEі€EіˆEіFіpEі>2Field-Applied Fusion-Bonded Epoxy (FBE) Pipe Coating Systems for Girth Weld Joints: Application, Performance, and Quality ControlT>2E8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3g{Z?2Joint Surface Preparation Standard White Metal Blast Cleaning-Item No. 21065T?2LE8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3Z@2Joint Surface Preparation Standard White Metal Blast Cleaning-Item No. 21065T@2LE8EjE hFjbpEj€EjˆEjFjpEjДФZA2Joint Surface Preparation Standard White Metal Blast Cleaning-Item No. 21065TA2LE!8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3B2Field-Applied Fusion-Bonded Epoxy (FBE) Pipe Coating Systems for Girth Weld Joints: Application, Performance, and Quality ControlTB2E#8ErE hFrbpEr€ErˆErFrpEr˜C2Earth-Moving Machinery - Braking Systems of Rubber-Tyred Machines - Systems and Performance Requirements and Test Procedures-Third EditionTC2ŠE%8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3TD2?Standard Test Methods for Felt.(Withdrawn 2004; No Replacement)T :Ice Hockey Pucks-Second Edition; General Instruction No 1; Update No 2T :FE(8E4E hF4bpE4€E4ˆE4F4pE4`E4T :1Red phosphorus for industrial use. SpecificationsT :1Red phosphorus for industrial use. SpecificationsHv3Mќp58… :Piston-Operated Volumetric Apparatus - Part 1: Terminology, General Requirements and User Recommendations-First EditionT :wE,8EюE hFюbpEю€EюˆEюFюpEюpEюZ :Piston-Operated Volumetric Apparatus - Part 2: Piston Pipettes-First EditionT :LE.8EюE hFюbpEю€EюˆEюFюpEюpEюZ:Piston-Operated Volumetric Apparatus - Part 3: Piston Burettes-First EditionT:LE08E4E hF4bpE4€E4ˆE4F4pE4pE4‰:Piston-Operated Volumetric Apparatus - Part 6: Gravimetric Methods for the Fetermination of Measurement Error-First EditionT:{E28E4E hF4bpE4€E4ˆE4F4pE4pE4l:General requirements for the competence of testing and calibration laboratories-Second editionT:^E48EЬE hFЬbpEЬ€EЬˆEЬFЬpEЬl:General requirements for the competence of testing and calibration laboratories-Second editionT:^E68EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3l:General requirements for the competence of testing and calibration laboratories-Second editionT:^E88EїE hFїbpEї€EїˆEїFїpEїž:Information and documentation — Records management processes — Metadata for records — Part 2: Conceptual and implementation issues-First EditionT:E:8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3:Information and documentation Records management processes "Metadata for records Part 1: Principles-First EditionT:sE<8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3pE^3fйAMedical laboratories — Particular requirements for quality and competence-Second editionTйAXE>8E 4E hF 4bpE 4€E 4ˆE 4F 4pE 4`E 4wкAMedical laboratories — Reduction of error through risk management and continual improvement-First EditionTкAiE@8EЩE hFЩbpEЩ€EЩˆEЩFЩpEЩКлAGraphical Symbols - Safety Colours and Safety Signs - Part 1: Design Principles for Safety Signs in Workplaces and Public Areas-First Edition; Corrected Version: 12/15/2003TлAЌEB8EкE hFкbpEк€EкˆEкFкpEк€мAGraphical symbols Safety colours and safety signs Safety signs used in workplaces and public areas-First EditionTмArED8EЩE hFЩbpEЩ€EЩˆEЩFЩpEЩpEЩ€нAFraphical symbols Safety colours and safety signs Safety signs used in workplaces and public areas-First EditionTнArEF8E 4E hF 4bpE 4€E 4ˆE 4F 4pE 4pE 4ŽоAGraphical symbols — Safety colours and safety signs — Safety signs used in workplaces and public areas AMENDMENT 2-First EditionTоA€EH8EкE hFкbpEк€EкˆEкFкpEкpEкпAŽпAGraphical symbols — Safety colours and safety signs — Safety"signs used in workplaces and public areas AMENDMENT 3-First EditionrEF8E 4E hF 4bpE 4€E 4ˆE 4F 4pE 4pE 4оAŽоAGraphical symbols — Safety colours and safety signs — Safety signs used in workplaces and public areas AMENDMENT 2-First EditionЎXђV3cФ@?„.і №6 8 ЕSХqёЩЛD№Š6ЕaУoЏCяƒ/ІRјЄJіqЩu!Эyсў Њ P ќ Ђ N є    Н 3 п ‰ 5 с%бZGѓ+Зcя›'гgЏ[Г`џF˜йE=FїXbЩTпA€EJƒ hFП€EПbzEПˆEПFПpEП]рAFire protection - Safety signs-First Edition; Corrected and Reprinted 9/10/1987TрAOF8E 4E hF 4bpE 4€E 4ˆE 4F 4pE 4pE 4‹сACriteria for Accreditation of Personnel Certification Bodies-Same as ISO/IEC 17024: 2003; Supersedes CAN-P-912 and CAN-P-1412TсA}F8EьLE hFьLbpEьL€EьLˆEьLFьLpEьLlтAGeneral requirements for the competence of testing and calibration laboratories-Second editionTтA^F8EъE hFъbpEъ€EъˆEъFъpEъiуAHealth informatics Requirements for an electronic health record architecture-First EditionTуA[F8EME hFMbpEM€EMˆEMFMpEM}фAHealth informatics — Public key infrastructure —"Part 1: Overview of digital certificate services-First EditionTфAoF 8EME hFMbpEM€EMˆEMFMpEMhхAHealth informatics — Public key infrastructure — Part 2: Certificate profile-First EditionTхAZF 8EME hFMbpEM€EMˆEMFMpEMpEMцAHealth informatics — Public key infrastructure — Part 3: Policy management of certification authority-First EditionTцAsF 8EфLE hFфLbpEфL€EфLˆEфLFфLpEфLчAInformation technology — Security techniques — Code of practice for information security management-First EditionTчAqF8En3E hFn3bpEn3€En3ˆEn3Fn3pEn3ЁшASterilization of medical devices Microbiological methods Part 1: Determination of a population of microorganisms on products-Second Edition;:2004TшA“F8E7ME hF7MbpE7M€E7MˆE7MF7MpE7MЁщASteriljzation of medical devices Microbiological methods Part 1: Determination of a population of microorganisms on products-Second Edition;:2004TщA“F8E7ME hF7MbpE7M€E7MˆE7MF7MpE7MpE7MЊъASterilization of Medical Devices - Microbiological Methods - Part 2: Tests of Sterility Performed in the Validation of a Sterilization Process-First EditionTъAœF8E7ME hF7MbpE7M€E7MˆE7MF7MpE7MpE7MOыANon-active surgical"implants — General requirements-Third EditionTыAAF8EME hFMbpEM€EMˆEMFMpEMpEMйьAImplants for surgery — Wear of total intervertebral spinal disc prostheses — Part 1: Loading and displacement parameters for wear testing and corresponding environmental conditions for test-First EditionTьAЫF8En3E hFn3bpEn3€En3ˆEn3Fn3pEn3pEn3UэACommercial Building Standard for Telecommunications Pathways and SpbcesTэAGF8EaME hFaMbpEaM€EaMˆEaMFaMpEaMzюAStandard Test Methods for Pressure Decay Leak Test for Flexible Packages With and Without Restraining PlatesTюAlF8EME hFMbpEM€EMˆEMFMpEMpEMсяAPackaging for terminally sterilized medical devices Part 1: Requirements for materials, sterile barrier systems and packaging systems-First edition; ISO 11607-1 and ISO 11607-2 cancel and replace ISO 11627:2003TяAгF8EaME hFaMbpEaM€EaMˆEaMFaMpEaMpEaMT№A7Quality Management Systems - Requirements-Third EditionTёA7Quality Management Systems - Requirements-Third EditionlЉISafety devices for protection against excessive pressure Part 1: Safety valves-Second EditionTЉI^F#8ErE hFrbpEr€ErˆErFrpEr`Er{ЊISafety Devices for Protection Against Excessive"Pressure - Part 2: Bursting Disc Safety Devices-First EditionTЊImF%8Eќ3E hFќ3bpEќ3€Eќ3ˆEќ3Fќ3pEќ3ЋISafety devices for protection against excessive pressure — Part 5: Controlled safety pressure relief systems (CSPRS)-First EditionTЋI‚F'8Eь3E hFь3bpEь3€Eь3ˆEь3Fь3pEь3ЈЌISafety devices for protection against excessive pressure — Part 5: Controlled safety pressure relief systems (CSPRS) TECHNICBL CORRIGENDUM 1-First EditionTЌIšF)8Eќ3E hFќ3bpEќ3€Eќ3ˆEќ3Fќ3pEќ3pEќ3Ј­ISafety devices for protection against excessive pressure — Part 5: Controlled safety pressure relief systems (CSPRS) TECHNICAL CORRIGENDUM 1-First EditionT­IšF+8Eќ3E hFќ3bpEќ3€Eќ3ˆEќ3Fќ3pEќ3pEќ3ЎIPlastics piping systems for non-pressure underground drainage and sewerage - Unplasticized poly(vinyl chloride) (PVC-U), polypropylene (PP) and polyethylene (PE) - Part 1: Specifications for ancillary fittings including shallow inspection chambersTЎIїF-8Ew3E hFw3bpEw3€Ew3ˆEw3Fw3pEw3ЏIPlastics piping systems for non-pressure underground drainage and sewerage - Unplasticized poly(vinyl chloride) (PVC-U), polypropylene (PP) and polyethylene (PE) - Part 1: Specifications for ancillary fittings including shallow inspection chambersTЏIїF/8EN3E hFN3brEN3€EN3ˆEN3FN3pEN3OАIInstrument Transformers-Third Edition; General Instruction No 1-2TАIAF18EПE hFПbpEП€EПˆEПFПpEПdБIAccess Scaffolding for Construction Purposes-Second Edition; General Instruction No. 1TБIVF38EВ3E hFВ3bpEВ3€EВ3ˆEВ3FВ3pEВ3[yQSmall Craft, Engine-Driven - Field of Vision from Helm Position-First EditionTyQMF58EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3`EN3WzQSmall Craft - Anchoring, Mooring and Towing - Strong Points-First EditionTzQIF78Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3[{QSmall craft Permanently installed petrol and diesel fuel tanks-First EditionT{QMF98EВ3E hFВ3bpEВ3€EВ3ˆEВ3FВ3pEВ3Д64z|QQuality management Customer satisfaction Guidelines for complaints handling in organizations-First EditionV|QlF;8Eф3E hFф3bpEф3€Eф3ˆEф3Fф3pEф3pEф3TIY<Graphical symbols — Public information symbols-Third EditionTJY (R) Pyrometrybols — Public information symbols-Third EditionTKY (R) PyrometryqLYStandard Specification for Copper, Bus Bar, Rod, and Shapes and General Purpose Rod, Bar and ShapesTLYcF@8EщE hFщbpEщ€EщˆEщFщpEщЩMYPaints and Varnishes - Determination of Specular Gloss of Non-Metallic Paint Films at 20 Degrees, 60 Degrees and 85 Degrees-Third Edition; AS/NZS 1580.602.2:1995; Corrigendum 1 02/15/1997TMYЛFB8EсE hFсbpEс€EсˆEсFсpEсg{NYЌNYPaints and Varnishes - Determination of Flow Time by Use of Flow Cups-Fourth Edition; Technical Corrigendum 1: 06-15-1994; Technical Corrigendum 2: 04-01-1999TNYžFD8EщE hFщbpEщ€EщˆEщFщpEщand 85 Degrees-Third Edition; AS/NZS 1580.602.2:1995; Corrigendum 1 02/15/1997TMYЛFB8EсE hFсbpEс€EсˆEсFсpEсg{щ=лОMљЅQ§ƒ/д€)еz&ТnЫЦrmqu!‘=ТnЎZ% б W  Ў Z  - о Š рŒы—іЂ#ЯNњ’>СmАD№eД`џL˜йfGљn%0ЌOYPaints and Varnishes - Determination of Flow Time by Use of Flow Cups-Fourth Edition; Technical Corrigendum 1: 06-15-1994; Technical Corrigendum 2: 04-01-1999TOYžG8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3dPYPaints, Varnishes and Printing Inks - Determination of Fineness of Grind-Third EditionTPYVG8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3SQYPaints and Varnishes - Bend Test (Cylindrical Mandrel)-Second EditionTQYEG8EщE hFщbpEщ€EщˆEщFщpEщpEщjRYPaints, varnishes and plastics — Determination of non-volatile-matter content-Fourth EditionTRY\G8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3SSYPaints and Varnishes - Determination of Film Thickness-Fourth EditionTSYEG8E_3E hF_2bpE_3€E_3ˆE_3F_3pE_3pE_3TTY3Paints and Varnishes - Cross-Cut Test-Third Edition€^D{UYPaints and varnishes — Determination of resistance to liquids — Part 2: Water immersion method-Second EditionTUYmG 8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3TVY@Paints and varnishes Bend test (conical mandrel)-Second EditionВWYGeometrical Product Specifications (GPS) — Surface texture: Profile method — Terms, definitions and surface texture parameters TECHNICAL CORRIGENDUM 1-First EditionTWYЄG8EсE hFсbpEс€EсˆEсFсpEсpEсvXYStandard Practice for Instrumental Reflectance Measurement of Color for Flat Glass, Coated, and UncoatedTXYhG8EщE hFщbpEщ€EщˆEщFщpEщpEщŽYYPaints and Varnishes - Determination of Density - Part 1: Pyknometer Method-First Edition; Replaces ISO 2811 Supercedes ISO 8962TZY€G8EсE hFсbpEс€EсˆEсFсpEсpEс‡ZYPaints and Varnishes - Determination of Density - Part 2: Immersed Body (Plummet) Method-First Edition; Replaces ISO 2811TZYyG8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3[YPaints and Varnishes - Determination of Density - Part 3: Oscillation Method-First Edition; Replaces ISO 2811 Supercedes ISO 8962T[YG8EщE hFщbpEщ€EщˆEщFщrEщpEщj\YPaints, varnishes and plastics — Determination of non-volatile-matter content-Fourth EditionT\Y\G8EВ3E hFВ3bpEВ3€EВ3ˆEВ3FВ3pEВ3g{y]YGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005T]YkG8EщE hFщbpEщ€EщˆEщFщpEщg{_aNatural Airflow Ventilators for Buildings-Third Edition; General Instruction No 1TaQG8EйE hFйbpEй€EйˆEйFйpEй`Eй€aInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340TarG8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3†aConformity assessment - Vocabulary and general principles (ISO/IEC 17000:2004); Trilingual version EN ISO/IEC 17000:2004TaxG 8Eh3E hFh3bpEh3€Eh3ˆEh3Fh3pEh3}aMeasurement management systems Requirements for measurement processes and measuring equipment-Premiшre EditionTaoG"8EjE hFjbpEj€EjˆEjFjpEj{aMeasurement Management Systems - Requirements for Measurement Processes and Measuring Equipment-First EditionTamG$8EсE hFсbpEс€EсˆEсFсpEсfaQuality management systems Guidelines for quality management in projects-Second EditionVaXG&8EсE hFсbpEс€EсˆEсFсpEсpEсыaPaper, Board, Pulps and Related Terms - Vocabulary - Part 4: Paper and Board Grades and Converted Products-First Edition; Together with ISO 4046-1, ISO 4046-2, ISO 4046-3 and ISO 4046-5, cancel and replaces ISO 4046: 1978TaнG(8EбE hFбbpEб€EбˆEбFбpEбT a9Standard Terminology Relating to Paper and Paper Products‹!aCriteria for Bccreditation of Personnel Certification Bodies-Same as ISO/IEC 17024: 2003; Supersedes CAN-P-912 and CAN-P-1412T!a}G+8EjE hFjbpEj€EjˆEjFjpEjn"aHealth informatics — Information security management in health using ISO/IEC 27002-First EditionT"a`G-8EjE hFjbpEj€EjˆEjFjpEjpEjn#aHealth informatics — Information security management in health using ISO/IEC 27002-First EditionT#a`G/8EjE hFjbpEj€EjˆEjFjpEjpEjc$aPlastics — Guidelines for the recovery and recycling of plastics waste-Second EditionT$aUG18EjE hFjbpEj€EjˆEjFjpEjc%aPlastics — Guidelines for the recovery and recycling of plastics waste-Second EditionT%aUG38EбE hFбbpEб€EбˆEбFбpEбT&a7Quality Management Systems - Requirements-Third EditionT'a7Quality Management Systems - Requirements-Third EditionV(aNAS Certification & Qualification of Nondestructive Test Personnel-REV 3T(aHG78EПE hFПbpEП€EПˆEПFПpEП^щhStandard Specification for Stranded Carbon Steel Wire Ropes for General PurposesTщhPG98EjE hFjbpEj€EjˆEjFjpEj`Ej`ъhInformation and Documentation - Records Management - Parv 1: General-First EditionTъhRG;8EбE hFбbpEб€EбˆEбFбpEбpEб`ыhInformation and Documentation - Records Management - Part 1: General-First EditionTыhRG=8ErE hFrbpEr€ErˆErFrpErcьhInformation and Documentation - Records Management - Part 2: Guidelines-First EditionTьhUG?8EйE hFйbpEй€EйˆEйFйpEйэhInformation and documentavion Records management processes Metadata for records Part 1: Principles-First EditionTэhsGA8ErE hFrbpEr€ErˆErFrpErpErTюh*Electronic Records as Documentary EvidenceTяh7Quality Management Systems - Requirements-Third Edition %T№h7Quality Management Systems - Requirements-Third Editionр@oёhInformation technology — Security techniques — Information security risk"management-First EditionTёhaGF8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3Tђh8Information and Documentation - Vocabulary-First EditionyѓhGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TѓhkGI8EщE hFщbpEщ€EщˆEщFщpEщєhuєhGENERAL REQUIREMENTS FOR BODIES OPERATING PRODUCT CERTIFICATION SYSTEMS-Same as ISO/IEB Guide 65 : 1996pEx3Tђh8Information and Documentation - Vocabulary-First EditionѓhyѓhGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TѓhkGI8EщE hFщbpEщ€EщˆEщFщpEщ ДGC (PC@ћ‚ ›9РlЉU­Yи„!ЭmЙeГ] ЕaўЊGѓ…1Уoф<Q§—CШtї Ѓ  Щ I ѕ – B Щ u З ( дMљkЁM›Gѓx$а})ПkФ` `џF˜й/SHће9€TєhgGKƒ hF_3€E_3bzE_3ˆE_3F_3pE_3{ѕhLubrication, Shaft-sealing and Oil-control Systems and Auxiliaries-Fifth Edition; Incorporates Errata: 5/2008TѕhmH8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3pE_3Tіh;Sound Control of Mechanical Equipment for Refinery ServicesTїh+Machinery Protection Systems-Fourth Editionefinery ServicesiјhSpecial-Purpose Couplings for Petroleum, Chemical, and Gas Industry Services-Fourth EditionTјh[H8Eo3E hFo3bpEo3€Eo3ˆEo3Fo3pEo3tљhCentrifugal Fans for Petroleum, Chemical and Gas for Industry Services-Second Edition; Errata: 10/2002TљhfH8Eo3E hFo3bpEo3€Eo3ˆEo3Fo3pEo3pEo3ˆњhPumps Shaft Sealing Systems for Centrifugal and Rotary Pumps-Thiqd Edition; ISO 21049 Adoption; Errata: November 10, 2006TњhzH 8EjE hFjbpEj€EjˆEjFjpEjlћhGeneral requirements for the competence of testing and calibration laboratories-Second editionTћh^H 8EщE hFщbpEщ€EщˆEщFщpEщшќhConformity assessment General requirements for accreditation bodies accrediting conformity assessment bodies-First Edition; Corrected Version 2/15/2005; Replaces ISM Guide 58:1993, ISO Guide 61:1996, ISO TR 17010:1998TќhкH 8Eї3E hFї3bpEї3€Eї3ˆEї3Fї3pEї3Ш§hMedical electrical equipment – Part 2-22: Particular requirements for basic safety and essential performance of surgical, cosmetic, therapeutic and diagnostic laser equipment-Edition 3.0T§hКH8EтE hFтbpEт€EтˆEтFтpEтTўh7Quality Management Systems - Requirements-Third EditiontЙqErgonomics of the thermal environment — Cold workplaces — Risk assessment and management-First EditionTЙpfH8Eo3E hFo3bpEo3€Eo3ˆEo3Fo3pEo3`Eo3tКpErgonomics of the thermal environment — Cold workplaces — Risk assessment and management-First EditionTКpfH8E4E hF4bpE4€E4ˆE4F4pE4tЛpErgonomics of the thermal environment — Cold workplaces — Risk assessment and management-First EditionTЛpfH8E4E hF4bpE4€E4ˆE4F4pE4pE4TМp=Founding - Technical conditions of delivery - Part 1: General%mНpFounding - Technical conditions of delivery - Part 3: Additional requirements for iron castingsTНp_H8EjE hFjbpEj€EjˆEjFjpEjTОpPlastics (I): D 256 - D 3159TПpPlastics (II): D 3222 - D 5083ШРpSterilization of health care products — Ethylene oxide — Part 1: Requirements for development, validation and routine control of a sterilization process for medical devices-First EditionTРpКH8ErE hFrbpEr€ErˆErFrpErДW3ПСpActivities relating to drinking water and wastewater services — Guidelines for the management of wastewater utilities and for the assessment of wastewater services-First editionTСpБH8ErE hFrbpEr€ErˆErFrpEr[ТpStatistics Vocabulary and symbols Part 2: Applied statistics-Second EditionTТpMH!8EПE hFПbpEП€EПˆEПFПpEПЉУpActivities relating to drinking water and wastewater services — Guidelines for the assessment and for the improvement of the service to users-First editionTУp›H#8ErE hFrbpEr€ErˆErFrpErpErVФpNAS Certieication & Qualification of Nondestructive Test Personnel-REV 3TФpHH%8EПE hFПbpEП€EПˆEПFПpEПl‰xGeneral requirements for the competence of testing and calibration laboratories-Second editionT‰x^H'8ER3E hFR3bpER3€ER3ˆER3FR3pER3`ER3lŠxGeneral requirements for the competence of testing and calibration laboratories-Second editionTŠx^H)8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯg{T‹x7Quality Management Systems - Requirements-Third EditionwŒxSoftware engineering Guidelines for the application of ISO 9001:2000 to computer software-First Edition;TŒxiH,8EjE hFjbpEj€EjˆEjFjpEjTx6Guidelines for quality management system documentationn`ŽxInformation and Documentation - Records Management - Part 1: General-First EditionTŽxRH/8E:4E hF:4bpE:4€E:4ˆE:4F:4pE:4ZxUse of 9Cr-1Mo-V (Grade 91) Steel in the Oil Refining Industry-First EditionTxLH18ErE hFrbpEr€ErˆErFrpErlxGeneral requirements for the competence of testing and calibration laboratories-Second editionTx^H38EљE hFљbpEљ€EљˆEљFљpEљ‘xCleanrooms and associated controlled environments Biocontamination controm Part 1: General principles and methods-First EditionT‘xH58ErE hFrbpEr€ErˆErFrpErЁ’xSterilization of medical devices Microbiological methods Part 1: Determination of a population of microorganisms on products-Second Edition;:2004T’x“H78Eo3E hFo3bpEo3€Eo3ˆEo3Fo3pEo3“xMedical electrical equipment – Recurrent test and test after repair of medical electrical equipment-First EditionT“xqH98Eo3E hFo3bpEo3€Eo3ˆEo3Fo3pEo3pEo3‚”xTesting of welded joints of thermoplastics semi-finished products Part 1: Bend tests-CORR 14807: November 28, 2003;T”xtH;8EИ3E hFИ3bpEИ3€EИ3ˆEИ3FИ3pEИ3 •xPolyethylene (PE) Pipes and Fittings - Determination of the Tensile Strength and Failure Mode of Test Pieces from a Butt-Fused Joint-First EditionT•x’H=8EсE hFсbpEс€EсˆEсFсpEсъ–xGuidelines for quality and/or environmental management systems auditing-ISO 19011:2002; Supersedes AS 3911.1, NZS 10011.1, AS 3911.2,NZS 10011.2, AS 3911.3, NZS 10011.3, AS/NZS ISO 14010,AS/NZS ISO 14011 AND AS/NZS 14012T–xмH?8EсE hFсbpEс€EсˆEсFсpEсpEсъ—xGuidelines for quality and/or environmental management systems auditing-ISO 19011:2002; Supersedes AS 3911.1, NZS 10011.1, AS 3911.2,NZS 10011.2, AS 3911.3, NZS 10011.3, AS/NZS ISO 14010,AS/NZS ISO 14011 AND AS/NZS 14012T—xмHA8EсE hFсbpEс€EсˆEсFсpEсpEсъ˜xGuidelines for quality and/or environmental management systems auditing-ISO 19011:2002; Supersedes AS 3911.1, NZS 10011.1, AS 3911.2,NZS 10011.2, AS 3911.3, NZS 10011.3, AS/NZS ISO 14010,AS/NZS ISO 14011 AND AS/NZS 14012T˜xмHC8Eй3E hFй3bpEй3€Eй3ˆEй3Fй3pEй3™xo™xFood safety management systems Requirements for any organization in the food chain-First Editionfor quality and/or environmental management systems auditing-ISO 19011:2002; Supersedes AS 3911.1, NZS 10011.1, AS 3911.2,NZS 10011.2, AS 3911.3, NZS 10011.3, AS/NZS ISO 14010,AS/NZS ISO 14011 AND AS/NZS 14012ШО ПDLПDШНDˆОDф‚˜DZШ(дRў+Š6ЇSч“9х…1нfОRў’>ш”ы—<ш ) е Й e  Є P ќ ˆ 4 РlјЄPˆ4LјŒ8А\ш”+зƒ/Д`џI˜йmIџfЂ6 T™xaHEƒ hFo3€Eo3bzEo3ˆEo3Fo3pEo3ДZ3lšxGeneral requirements for the competence of testing and calibration laboratories-Second editionTšx^I8Eй3E hFй3bpEй3€Eй3ˆEй3Fй3pEй3pEй3l›xGeneral requirements for the competence of testing and calibration laboratories-Second editionT›x^I8EjE hFjbpEj€EjˆEjFjpEjdœxAccess Scaffolding for Construction Purposes-Second Edition; General Instruction No. 1TœxVI8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3axEnvironmental management systems Requirements with guidance for use-Second EditionTxSI8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧUžxControl Charts for Arithmetic Average with Warning Limits First EditionTžxGI 8Eб3E hFб3bpEб3€Eб3ˆEб3Fб3pEб3TŸx9Control charts — Part 1: General guidelines-First Edition€^D\ xShewhart Control Charts (AS/NZS 3944: 1993)-First Edition; Corrigendum 1: 1993T xNI 8ErE hFrbpEr€ErˆErFrpErДш3TЁx6Labels, Permanent for Underhood and Protected Exteriorion€^DpЂxGeneral requirements for components used in discharge pipes, drains and sewers for gravity systemsTЂxbI8E4E hF4bpE4€E4ˆE4F4pE4pE4ЌЃxMedical Electrical Equipment - Part 1-1: General Requirements for Safety - Collateral Standard: Safety Requirements for Medical Electrical Systems-Edition 2.0TЃxžI8ErE hFrbpEr€ErˆErFrpErnЄxTechnical product documentation Data fields in title blocks and document headers-Second EditionTЄx`I8EёE hFёbpEё€EёˆEёFёpEё™ЅxSurface Active Agents - Washing Powders - Determination of Apparent Density - Method by Measuring the Mass of a Given Volume-Second EditionTЅx‹I8ER3E hFR3bpER3€ER3ˆER3FR3pER3xІxRecommended Practice for Powering and Grounding Electronic Equipment-IEEE Emerald Book (Color Book Series)TІxjI8ErE hFrbpEr€ErˆErFrpErTЇxSafe Use of LasersTЈxSafe Use of LasersTЉxSafe Use of LasersTЊx7Quality Management Systems - Requirements-Third EditionTЋx7Quality Management Systems - Requirements-Third EditionƒY€Basic Environmental Testing Procedures Part 2: Tests Test N: Change of Temperature-Fifth Edition; Amendment 2: 4-1986TY€uI8E.LE hF.LbpE.L€E.LˆE.LF.LpE.L`E.LTZ€:Sacs A Dechets En Plastique (Remplace CAN/CGSB- 156.1-M87)T[€Plastic Garbage Bagsastique (Remplace CAN/CGSB- 156.1-M87)”)ˆ8 mm THROUGH 200 mm EMBOSSED CARRIER TAPING AND 8 mm & 12 mm PUNCHED CARRIER TAPING OF SURFACE MOUNT COMPONENTS FOR AUTOMATIC HANDLINGT)ˆ†I"8EПE hFПbpEП€EПˆEПFПpEП`EПwљClinibal Investigation of Medical Devices for Human Subjects - Part 1: General Requirements-First EditionTљiI$8EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3`EЭ3ЬњClinical Investigation of Medical Devices for Human Subjects - Part 2: Clinical Investigation Plans-First Edition; Together with the first edition of 14155-1 Cancels and Replaces 14155: 1996TњОI&8Ew3E hFw3bpEw3€Ew3ˆEw3Fw3pEw3АћMedical devices — Symbols vo be used with medical device labels, labelling and information to be supplied — Part 1: General requirements AMENDMENT 1-First editionTћЂI(8Ew3E hFw3bpEw3€Ew3ˆEw3Fw3pEw3pEw3qќInformation technology - Security techniques - Code of practice for information security managementTќcI*8EПE hFПbpEП€EПˆEПFПpEПo§Information technology — Security techniques — Information security risk management-First EditionT§aI,8Eє3E hFє3bpEє3€Eє3ˆEє3Fє3pEє3TЩ—2Digital C4FM/CQPSK Transceiver Measurement Methods= T TЪ—2Digital C4FM/CQPSK Transceiver Measurement MethodsЫ—Wireless Communications Systems - Performance in Noise and Interference - Limited Situations - Recommended Methods for Technology - Independent Modeling, Simulation, and Verifications-Extra files posted online - Extra files on CD-ROM available upon requestTЫ—I08EA4E hFA4bpEA4€EA4ˆEA4FA4pEA4pEA4рЬ—Wireless Communications Systems - Performance in Noise and Interference - Limited Situations - Recommended Methods for Technology - Independent Modeling, Simulation, and Verifications-Addendum No. 1 to TSB-88-BTЬ—вI28EзE hFзbpEз€EзˆEзFзpEзpEзTЭ—Project 25 Trunking Procedures"0,<  %TЮ—@GUIDELINES FOR CORRECTIVE ACTION-Same as ISO/IEC Guide 27 : 1983TЯ—7Quality Management Systems - Requirements-Third EditionTа—7Quality Management Systems - Requirements-Third EditionЊB†B}б—Quality Management Systems - Guidelines for Performance Improvements-Second Edition; Supersedes ISO 9004-1:1994Tб—oI88Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3ДП3Ђв—Environmental Testing Part 2: Test Methods Test"Fh: Vibration, Broad-Band Random (Digital Control) and Guidance-First Edition; Corrigendum 1:10/1993Tв—”I:8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3pEg3lг—General requirements for the competence of testing and calibration laboratories-Second editionTг—^I<8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3pEg3д—Environmental testing - Part 2: Test methods - Test Fh: Vibration, broad-band random (digital control) and guidanceTж—sI>8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3Tе—@Occupational health and safety management systems - requirementsrж—Occupational health and safety management systems - Guidelines for the implementation of OHSAS 18001Tж—dIA8EсE hFсbpEс€EсˆEсFсpEсpEсrз—Occupational health and safety management systems - Guidelines for the implementation of OHSAS 18001Tз—dIC8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3Žи—Occupational health and safety management systems Guidelines for the implementation of OHSAS 18001-AMD 14224: December 13, 2002Tи—€IE8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3žй—Proficiency Testing by Interlaboratory Comparisions - Part 1: Development and Operation of Laboratory Proficiency Testing Schemes-Second EditionTй—IG8EсE hFсbpEс€EсˆEсFсpEсpEсtation of OHSAS 18001-AMD 14224: December 13, 2002Tи—€IE8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3й—žй—Proficiency Testing by Interlaboratory Comparisions - Part 1: Development and Operation of Laboratory Proficiency Testing Schemes-Second EditionONG>CAN-P-phoresis (COfiler™ and Profiler Plus ™ PCR­Л-йgЁMљx$ИdТnёIѕЁMm Зc Lл‡зƒЗcь ˜  А \  … 1 н ‰ 5 с   С(дffЂNњžJіЁMь˜4рt Д`џI˜й§JЮ hT ­к—Proficiency Testing by Interlaboratory Comparisions - Part 2: Selection and Use of Proficiency Testing Schemes by laboratory Accreditation Bodies-First EditionTк—ŸJ8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3­л—Proficiency Testing by Interlaboratory Comparisions - Part 2: Selection and Use of Proficiency Testing Schemes by laboratory Accreditation Bodies-First EditionTл—ŸJ8Ew3E hFw3bpEw3€Ew3ˆEw3Fw3pEw3aм—Environmental management systems Requirements with guidance for use-Second EditionTм—SJ8Ew3E hFw3bpEw3€Ew3ˆEw3Fw3pEw3pEw3ž™ŸInformation technology — Security techniques — Guidelines for information and communications technology disaster recovery services-First editionT™ŸJ8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3`EN3TšŸ"VERIFICATION OF FIRE ALARM SYSTEMSjˆOj>у0%lЩT›Ÿ0INSTALLATION OF FIRE ALARM SYSTEMS-Fifth EditionTœŸ&National Electrical Code -2008 Editionj>у0%lЩTŸ.Drinking water treatment systems-First EditiononTžŸ.Drinking water treatment systems-First Edition>у0%lЩГŸŸFOTP-176 Method for Measuring Optical Fiber Cross-Sectional Geometry"by Automated Grey-Scale Analysis-Withdrawn May 2003; THIS PUBLICATION IS CURRENTLY NOT AVAILABLETŸŸЅJ 8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3q ŸProtecteurs Oculaires Et Faciaux Pour LДIndustrie-Cinquieme Edition; Fiche No 1-2; Mise A Jour No 3T ŸcJ8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3lЁŸGeneral requirements for the competence of testing and calibration laboratories-Second editionTЁŸ^J8Eo3E hFo3bpEo3€Eo3ˆEo3Fo3pEo3UЂŸCommercial Building Standard for Telecommunications Pathways and SpacesTЂŸGJ8Eo3E hFo3bpEo3€Eo3ˆEo3Fo3pEo3pEo3TЃŸ7Quality Management Systems - Requirements-Third EditionjЄŸGuide for the Implementation of Inductive Coordination Mitigation Techniques and ApplicationTЄŸ\J8EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3hЅŸRecommended Practice for Inductive Coordination of Electric Supply and Communication LinesTЅŸZJ8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3jІŸGuide for the Implementation of Inductive Coordination Mitigation Techniques and ApplicationTІŸ\J8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3uЇŸDocumentation - Guidelines for the Establishment and Development of Multilingual Thesauri First EditionTЇŸgJ8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3VЈŸMetallic Gaskets for Pipe Flanges Ring-Joint, Spiral-Wound, and JacketedTЈŸHJ8EПE hFПbpEП€EПˆEПFПpEПrЉŸBamboo Determination of physical and mechanical properties Part 2: Laboratory manual-First EditionTЉŸdJ 8EПE hFПbpEП€EПˆEПFПpEПpEП‚ЊŸSoftware engineering - Software product Quality Requirements and Evaluation (SQuaRE) - Guide to SQuaRE-First EditionTЊŸtJ"8Ew3E hFw3bpEw3€Ew3ˆEw3Fw3pEw3bЋŸNon-Destructive Testing - Qualification and Certification of Personnel-ISO 9712:2005TЋŸTJ$8Eй3E hFй3bpEй3€Eй3ˆEй3Fй3pEй3_ЌŸNatural Airflow Ventilators for Buildings-Third Edition; General Instruction No 1TЌŸQJ&8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3Z­ŸPiston-Operbted Volumetric Apparatus - Part 3: Piston Burettes-First EditionT­ŸLJ(8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3SЎŸPiston-Operated Volumetric Apparatus - Part 4: Dilutors-First EditionTЎŸEJ*8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧaЏŸEnvironmental management systems Requirements with guidance for use-Second EditionTЏŸSJ,8EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3TАŸ2Specification for Sucker Rods-Twenty-Sixth EditionюB€?šБŸInternal Abrasive Blast Cleaning of Ferritic Piping-Special Standard: PDF does not include pages 6 and 7; Should be printed on color printerTБŸŒJ/8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯTВŸQuality Management Systems - Fundamentals and Vocabulary-Third EditionTВŸFJ18Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3}ГŸQuality Management Systfms - Guidelines for Performance Improvements-Second Edition; Supersedes ISO 9004-1:1994TГŸoJ38EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯpEЯƒДŸInformation technology Security techniques Information security management systems Requirements-ISO/IEC 27001:2005TДŸuJ58Eo3E hFo3bpEo3€Eo3ˆEo3Fo3pEo3g{’ЕŸRules for steam turbine thermal acceptance tests - Part 2: Method B - Wide range of accuracy for various types bnd sizes of turbinesTЕŸ„J78EИ3E hFИ3bpEИ3€EИ3ˆEИ3FИ3pEИ3ЖŸRules for steam turbine thermal acceptance tests - Part 3: Thermal performance verification tests of retrofitted steam turbinesTЖŸJ98EИ3E hFИ3bpEИ3€EИ3ˆEИ3FИ3pEИ3pEИ3TЗŸ8Acceptance tests for steam turbine speed control systems=W"ƒYo3TИŸ!Industrial process control valvesсЙŸJndustrial, scientific and medical (ISM) radio-frequency equipment – Electromagnetic disturbance characteristics – Limits and methods of measurement-Edition 4.1; Edition 4:2003 Consolidated with Amendment 1:2004TЙŸгJ=8EИ3E hFИ3bpEИ3€EИ3ˆEИ3FИ3pEИ3pEИ3TКŸRADIO FREQUENCY DEVICESr Rods-Twenty-Sixth EditionюB€?сЛŸIndustrial, scientific and medical (ISM) radio-frequency equipment – Electromagnetic disturbance characteristics – Limivs and methods of measurement-Edition 4.1; Edition 4:2003 Consolidated with Amendment 1:2004TЛŸгJ@8EсE hFсbpEс€EсˆEсFсpEсДУ3TМŸRADIO FREQUENCY DEVICESr Rods-Twenty-Sixth EditionюB€?TНŸRADIO FREQUENCY DEVICESr Rods-Twenty-Sixth EditionюB€?сОŸIndustrial, scientific and medical (ISM) radio-frequency equipment – Electromagnetic disturbance characteristics – Limits and methods of measurement-Editinn 4.1; Edition 4:2003 Consolidated with Amendment 1:2004TОŸгJD8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯpEЯ|ПŸRoad vehicles — Controller area network (CAN) — Part 1: Data link layer and physical signalling -First EditionTПŸnJF8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3РŸ“РŸRoad vehicles — Controller area network (CAN) — Part 1: Data link layer and physical signalling TECHNICAL CORRIGENDUM 1-First EditionFЯpEЯpEЯПŸ|ПŸRoad vehicles — Controller area network (CAN) — Part 1: Data link layer and physical signalling -First EditionTПŸnJF8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3ўТxv @`ЗЇЇ2№6pгТШО џТjŒ8WЏ[z&вёIѕh‚.ЋWк†2оD№œ;ч”@ц’3п})Ї S с  7 у n  А \ є   6 тŽ9хy%Д`­YБ] ЕУba `џE˜йeKиW'TРŸ…JHƒ hFN3€EN3bzEN3ˆEN3FN3pEN3g{ŸСŸRoad vehicles Controller area network (CAN) Part 2: High-speed medium access unit-First Edition; Together with 11898-1:2003 Replaces 11898:1993TСŸ‘K8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3ЅТŸOptical fibre cables – Part 4-10: Aerial optical cables along electrical power lines – Family specification for OPGW (Optical Ground Wires)-Edition 1.0TТŸ—K8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯДmlУŸGeneral requirements for the competence of testing and calibration laboratories-Second editionTУŸ^K8Eй3E hFй3bpEй3€Eй3ˆEй3Fй3pEй3lФŸGeneral requirements for the competence of testing and calibration laboratories-Second editionTФŸ^K8Ew3E hFw3bpEw3€Ew3ˆEw3Fw3pEw3„ХŸGeneral requirements for the competence of testing and calibration laboratories TECHNICAL CORRIGENDUM 1-Second editionTХŸvK 8Ew3E hFw3bpEw3€Ew3ˆEw3Fw3pEw3pEw3oЦŸGeneral Requirements for the Competence of Calibration and Testing Laboratories-Troisieme editionTЦŸaK 8Eй3E hFй3bpEй3€Eй3ˆEй3Fй3pEй3pEй3‚ЧŸSoftware Engineering - Product Quality - Part 1: Qualiuy Model-First Edition; Cancels and Replaces ISO/IEC 9126:1991TЧŸtK 8EПE hFПbpEП€EПˆEПFПpEП]ШŸSoftware Engineering - Product Quality - Part 2: External Metrics-First EditionTШŸOK8Ew3E hFw3bpEw3€Ew3ˆEw3Fw3pEw3aЩŸSoftware engineering Product quality Part 4: Quality in use metrics-First EditionTЩŸSK8Eo3E hFo3bpEo3€Eo3ˆEo3Fo3pEo3^ЪŸSoftware engineering Product quality Part 1: Quality model-ISO/IEC 9126-1:2001TЪŸPK8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧQЫŸPlastics - Preparation of Test Specimens by Machining Third EditionTЫŸCK8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3[ЬŸPlastics — Preparation of test specimens by machining TECHNICAL CORRIGENDUM 1TЬŸMK8EћE hFћbpEћ€EћˆEћFћpEћUЭŸ7Quality Management Systems - Requirements-Third EditionЊB†B’ЮŸAcceptance Test and Reverification Test for Coordinate Measuring Machines (CMMs) — Part 2: CMMs Used for Measuring Linear DimensionsTЮŸ„K8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3g{—ЯŸMetallic Coatings - Hot Dip Galvanized Coatings on Ferrous Materials - Gravimetric Determination of the Mass per Unit Area-Second EditionTЯŸ‰K8Ew3E hFw3bpEw3€Ew3ˆEw3Fw3pEw3ЋаŸInformation Technology - Security Techniques - Message Authentication Codes (MACs) - Part 1: Mechanisms Using a Block Cipher-First Edition; Replaces ISO 9797TаŸK8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3ЋбŸInformation Technology - Security Techniques - Message Authentication Codes (MACs) - Part 1: Mechanisms Using a Block Cipher-First Edition; Replaces ISO 9797TбŸK 8EсE hFсbpEс€EсˆEсFсpEс$!Н3­вŸMechanical vibration and shock—Hand-arm vibration—Method for the measurement and evaluation of the vibration transmissibility of gloves at the palm of the handTвŸŸK"8EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3lгŸGeneral requirements for the competence of testing and calibration laboratories-Second editionTгŸ^K$8EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3pEЭ3­дŸMechanical vibrauion and shock—Hand-arm vibration—Method for the measurement and evaluation of the vibration transmissibility of gloves at the palm of the handTдŸŸK&8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯkеŸAnaesthesia and Respiratory Care Alarm Signals - Part 2: Auditory Alarm Signals First EditionTеŸ]K(8E4E hF4bpE4€E4ˆE4F4pE4жŸMedical devices Quality management systems Requirements for regulatory purposeq-Second Edition; ISO 13485: 1996TжŸqK*8EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3зŸMedical devices Quality management systems Requirements for regulatory purposes-Second Edition; ISO 13485: 1996TзŸqK,8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3иŸMedical devices Quality management systems Requirements for regulatory purposes-Second Edition; ISO 13485: 1996TиŸqK.8E'4E hF'4bpE'4€E'4ˆE'4F'4pE'4йŸMedical devices Quality management systems Requirements for regulatory purposes-Second Edition; ISO 13485: 1996TйŸqK08E'4E hF'4bpE'4€E'4ˆE'4F'4pE'4pE'4кŸMedical devices Quality management systems Requirements for regulatory purposes-Second Edition; ISO 13485: 1996TкŸqK28E'4E hF'4bpE'4€E'4ˆE'4F'4pE'4pE'4лŸMedical devices Quality management systems Requirements for regulatory purposes-Second Edition; ISO 13485: 1996TлŸqK48E'4E hF'4bpE'4€E'4ˆE'4F'4pE'4pE'4ЗмŸGreenhouse gases Part 1: Specification with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-ISO 14064-1:2006TмŸЉK68E4E hF4bpE4€E4ˆE4F4pE4ЗнŸGreenhouse gases Part 1: Specification with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-ISO 14064-1:2006TнŸЉK88E4E hF4bpE4€E4ˆE4F4pE4ЗоŸGreenhouse gases Part 1: Specification with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-ISO 14064-1:2006TоŸЉK:8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3№пŸGaz р effet de serre Partie 1: Spщcifications et lignes direatrices, au niveau des organismes, pour la quantification et la dщclaration des щmissions et des suppression des gaz р effet de serre-First Edition; ISO 14064-1:2006TпŸтK<8EћE hFћbpEћ€EћˆEћFћpEћрŸGaz р effet de serre Partie 2: Spщcifications et lignes directrices, au niveau des projets, pour la quantification, la surveillance et la dщclaration des rщductions d'щmissions ou d'accroissements de suppressions des gaz р effet de serre-First Edition; ISO 14064-2:2006TрŸK>8EћE hFћbpEћ€EћˆEћFћpEћpEћRсŸInstrument transformers – Part 1: Current transformers-First EditionTсŸDK@8E'4E hF'4bpE'4€E'4ˆE'4F'4pE'4\тŸInstrument transformers – Part 2: Inductive voltage transformers-first editionTтŸNKB8E 4E hF 4bpE 4€E 4ˆE 4F 4pE 4уŸSуŸInstrument transformers — Part 3: Comained transformers-First EditionŸRсŸInstrument transformers – Part 1: Current transformers-First EditionTсŸDK@8E'4E hF'4bpE'4€E'4ˆE'4F'4pE'4тŸ\тŸInstrument transformers – Part 2: Inductive voltage transformers-first editionЬjКhјЄД`ЉUžJ“?Рlэ™ЦGѓt ЁMтŽс!Э Ь ! Э " Ю 7 у Q § Љ N њЉUїЃBю‘=ЛgјЄ Ь`  LЇSД`џA˜йeLШ0TуŸEKDƒ hF'4€E'4bzE'4ˆE'4F'4pE'4pE'4]фŸInstrument transformers – Part 7: Electronic voltage transformers-First EditionTфŸOL8EћE hFћbpEћ€EћˆEћFћpEћpEћ]хŸInstrument transformers — Part 8: Electronic current transformers-First EditionTхŸOL8EћE hFћbpEћ€EћˆEћFћpEћpEћTцŸ#Copper and copper alloys. Forgings.C€?`ЊB†BTчŸ?Audio, video, and similar electronic equipment-Eleventh EditionlшŸAcoustics - Statistical Distribution of Hearing Thresholds as a Function of Age-Second EditionTшŸ^L8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯšщŸGreenhouse gases - Requirements for greenhouse gas validation and verification bodies for use in accreditation or ouher forms of recognitionTщŸŒL 8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯpEЯ€ъŸHeat Treatment of Steel Raw Materials-Should Be Used Instead of MIL-H-6875, Which Was Cancelled on 2 February 1999TъŸrL 8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3VыŸNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TыŸHL 8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3{ьŸInsulation coordination for equipment within low-voltage systems - Part 1: Principles, requirements and testsTьŸmL8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3 эŸDynamic Exterior Vehicle Water Ingestion Test-Engl; Contains Color: GM RESTRICTED/CONFIDENTIAL STANDARD – To purchase call 1-800-854-7179 USA/Canada or 303-397-7956 Worldwide; Replaces GME8754, GME8755, GMN5110, GMPTE-T VEF002, GMPTE-T VEF003, GMW14548TэŸќL8EЧE hFЧbpEЧ€EЧ‰EЧFЧpEЧ юŸDynamic Exterior Vehicle Water Ingestion Test-Engl; Contains Color: GM RESTRICTED/CONFIDENTIAL STANDARD – To purchase call 1-800-854-7179 USA/Canada or 303-397-7956 Worldwide; Replaces GME8754, GME8755, GMN5110, GMPTE-T VEF002, GMPTE-T VEF003, GMW14548TюŸќL8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧpEЧTяŸRESISTANCE TO SCRATCHING<5Mc <  %T№ŸRESISTANCE TO SCRATCHING‘ёŸBiological Evaluation of Medical Devices - Part 7: Ethylene Oxide Sterilization Residuals First Edition; (CEN EN ISO 10993-7: 1995)TёŸƒL8EћE hFћbpEћ€EћˆEћFћpEћКђŸSterilization of health care products - Ethylene oxide - Part 1: Requirements for development, validation and routine control of a sterilization process for medical devicesTђŸЌL8EсE hFсbpEс€EсˆEсFсpEсpEссѓŸPackaging for terminally sterilized medical devices Part 1: Requirements for materials, sterile barrier systems and packaging systems-First edition; ISO 11607-1 and ISO 11607-2 cancel and replace ISO 11607:2003TѓŸгL8EсE hFсbpEс€EсˆEсFсpEсpEслєŸPackaging for terminally sterilized medical devices Part 2: Validation requirements for forming, sealing and assembly processes-First edition; ISO 11607-1 and ISO 11607-2 aancel and replace ISO 11607:2003TєŸЭL8E4E hF4bpE4€E4ˆE4F4pE4pE4ШѕŸSterilization of health care products — Ethylene oxide — Part 1: Requirements for development, validation and routine control of a sterilization process for medical devices-First EditionTѕŸКL8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧpEЧlіŸGeneral requirements for the competence of testing and calibration laboratories-Second editionTіŸ^L!8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧpEЧДїŸISO General Purpose Metric Screw Threads - Tolerances - Part 2: Limits of Sizes for General Purpose External and Internal Screw Threads - Medium Quality-Third EditionTїŸІL#8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3јŸMethod for Determination of Thickness and Apparent Bulk Density or Apparent Sheet Density of Paper and Board-AMD 7810: February 15, 1994; Renumbers BS 3993: 1989; Supersedes BS 3983-1 and -2:1982; Superseded by BS EN ISO 534:2005; ISO 534:1988TјŸѓL%8E'4E hF'4bpE'4€E'4ˆE'4F'4pE'4TљŸ7Quality Management Systems - Requirements-Third EditionTњŸ7Quality Management Systems - Requirements-Third EditionTћŸ7Quality Management Systems - Requirements-Third EditionаfќŸCommercial Building Grounding (Earthing) and Bonding Requirements for TemecommunicationsTќŸXL*8EсE hFсbpEс€EсˆEсFсpEсpEсl§ŸAcoustics - Measurement of Noise on Board Vessels-Second Edition; Technical Corrigendum 1-1997T§Ÿ^L,8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3шџџџlўŸGeneral requirements for the competence of testing and calibration laboratories-Second editionTўŸ^L.8E 4E hF 4bpE 4€E 4ˆE 4F 4pE 4OџŸContainers, Meual, Aerosol, (TC-2P, TC-2Q)-Supersedes 43-GP-123MPTџŸAL08EjE hFjbpEj€EjˆEjFjpEj• Urine-absorbing aids for incontinence - Test methods for characterizing polymer-based absorbent materials - Part 1: Determination of pHT ‡L28E"4E hF"4bpE"4€E"4ˆE"4F"4pE"4г Urine-Absorbing Aids for Incontinence - Test Methods for Characterizing Polymer-Based Absorbent Materials - Part 5: Gravimetric Deuermination of Free Swell Capacity in Saline Solution-First EditionT ХL48EC4E hFC4bpEC4€EC4ˆEC4FC4pEC4э Urine-Absorbing Aids for Incontinence - Test Methods for Characterizing Polymer-Based Absorbent Materials - Part 6: Gravimetric Determination of Fluid Retention Capacity in Saline Soultion After Centrifugation-First EditionT пL68E4E hF4bpE4€E4ˆE4F4pE4шџџџЦ Urine-Absorbing Aids for Imcontinence - Test Methods for Characterizing Polymer-Based Absorbent Materials - Part 7: Gravimetric Determination of Absorption under Pressure-First EditionT ИL88EC4E hFC4bpEC4€EC4ˆEC4FC4pEC4г Urine-Absorbing Aids for Incontinence - Test Methods for Characterizing Polymer-Based Absorbent Materials - Part 5: Gravimetric Determination of Free Swell Capacity in Saline Solution-First EditionT ХL:8E4E hF4bpE4€E5ˆE4F4pE4ctriЕ Urine-Absorbing Aids for Incontinence - Test Methods for Characterizing Polymer-Based Absorbent Materials - Part 8: Gravimetric Determination of Flowrate-First EditionT ЇL<8E;4E hF;4bpE;4€E;4ˆE;4F;4pE;4P Urine-Absorbing Aids - Part 1: Whole-Product Testing First EditionT BL>8E4E hF4bpE4€E4ˆE4F4pE4pE4T <A DTV Profile for Uncompressed High Speed Digital Interfaces tric Determination of Flowrate-First EditionT ЇL<8E;4E hF;4bpE;4€E;4ˆE;4F;4pE;4 P Urine-Absorbing Aids - Part 1: Whole-Product Testing First EditionT BL>8E4E hF4bpE4€E4ˆE4F4pE4pE4˜о/ hГџџџџј ŒшХq!ЭФёзƒ–Bo†2у#ЯcЉU­YXPќ<t E ё  М  Ў  Щ u ! УЙeъ–@ьl~*ОjТeД`џJ˜й]MЪbЏШ m Safety of machinery – Electrical equipment of machines – Part 1: General requirements-Edition 5T _M8E"4E hF"4bpE"4€E"4ˆE"4F"4pE"4pE"4o  General Criteria for the Operation of Various Types of Bodies Performing Inspection-First EditionT  aM8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3g  Bottom Loading and Vapor Recovery for MC-306 & DOT-406 Tank Motor Vehicles-Eighth EditionT  YM8EьLE hFьLbpEьL€EьLˆEьLFьLpEьLT  @Standard Practice for on-Site Inspection of Installed Fire Stopsw  General Specification for Electrical/Electronic Components – Environmental/Durability-English; Revision GT  iM8EРNE hFРNbpEРN€EРNˆEРNFРNpEРNa  Environmental management systems Requirements with!guidance for use-Second EditionT  SM 8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3T 2Brique de maчonnerie cuite en argile ou en schisteh Compressed Breathing Air and Systems-Fourth Edition; General Instruction No 1; Update No 2T ZM 8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3Дmh Compressed Breathing Air and Systems-Fourth Edition; General Instruction No 1; Update No 2T ZM8E4E hF4bpE4€E4ˆE4F4pE4\ Safeguarding of machinery-Second Edition; Incorporated Update 1: November 2006T NM8EЭ3E hFЭ3bpEЭ3€EЭ3ˆEЭ3FЭ3pEЭ3\ Safeguarding of machinery-Second Edition; Incorporated Update 1: November 2006T NM8E;4E hF;4bpE;4€E;4ˆE;4F;4pE;4\ Safeguarding of machinery-Second Edition; Incorporated Update 1: November 2006T NM8E4E hF4bpE4€E4ˆE4F4pE4g{\ Safeguarding of machinery-Second Edition; Incorporated Update 1: November 2006T NM8E4E hF4bpE4€E4ˆE4F4pE4pE4\ Safeguarding of machinery-Second Edition; Incorporated Update 1: November 2006T NM8E34E hF34bpE34€E34ˆE34F34pE34\ Safeguarding of machinery-Second Edition; Incorporated Update 1: Nmvember 2006T NM8E;4E hF;4bpE;4€E;4ˆE;4F;4pE;4pE;4T $Specification for Slewing jib cranesМ Conformity assessment Requirements for bodies providing audit and certification of management systems-First Edition; Replaces ISO/IEC Guide 62:1996 and ISO/IEC Guide 66:1999T ЎM8EсE hFсbpEс€EсˆEсFсpEс~ Information technology Security techniques Cmde of practice for information security management-Second EditionT pM8E4E hF4bpE4€E4ˆE4F4pE4u Non-destructive testing of welds Eddy current testing of welds by complex-plane analysis-First EditionT gM!8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3W Non-destructive testing of welds Magnetic particle testing-First EditionT IM#8EjE hFjbpEj€EjˆEjFjpEia Non-destructive testing of welds Ultrasonic testing of welded joints-First EditionT SM%8EjE hFjbpEj€EjˆEjFjpEjpEjT 4Planification des mesures et interventions d’urgencey Cleanrooms and Associated Controlled Environments - Part 4: Design, Construction and Start-Up-First EditionT kM(8EћE hFћbpEћ€EћˆEћFћpEћ Ceramic Tiles - Paqt 5: Determination of Impact Resistance by Measurement of Coefficient of Restitution-First Edition; Corrigendum 1 02/15/1997T M*8E4E hF4bpE4€E4ˆE4F4pE4j  Code d’installation du gaz naturel et du propane-Treizieme Edition; Supplщment nК 1: 01/2007T  \M,8E4E hF4bpE4€E4ˆE4F4pE4pE4j! Code d’installation du gaz naturel et du propane-Treizieme Edition; Supplщment nК 1: 01/2007T!Ё\M.8E4E hF4bpE4€E4ˆE4F4pE4pE4" Identification cards — Contactless integrated circuit cards — Proximity cards — Part 1: Physical characteristics-Second EditionT" M08ElME hFlMbpElM€ElMˆElMFlMpElM# Identification cards — Contactless integrated circuit cards — Proximity cards — Part 1: Physical characteristics-Second EditionT# M28ElME hFlMbpElM€ElMˆElMElMpElMpElM$ Identification cards — Contactless integrated circuit cards — Proximity cards — Part 1: Physical characteristics-Second EditionT$ M48ElME hFlMbpElM€ElMˆElMFlMpElMpElM§% Identification cards — Contactless integrated circuit(s) cards — Proximity cards — Part 2: Radio frequency power and signal interface AMENDMENT 1: Bit rates of fc/64, fc/32 and fc/16 TECHNICAL CORRIGENDUM 1-Technical Corrigendum 1 to AMD 1T% яM68E8EћE hFћbpEћ€EћˆEћFћpEћj* Medical devices - Quality management systems - Guidance on the application of ISO 13485:2003T* \M@8ElME hFlMbpElM€ElMˆElMFlMpElMpElMn+ Medical devices Quality management systems Requirements for regulatory purposes-Second EditionT+ `MB8EЌME hFЌMbpEЌM€EЌMˆEЌMFЌMpEЌMl, General requirements for the compeuence of testing and calibration laboratories-Second editionT, ^MD8EjE hFjbpEj€EjˆEjFjpEjl- General requirements for the competence of testing and calibration laboratories-Second editionT- ^MF8E 4E hF 4bpE 4€E 4ˆE 4F 4pE 4. l. General requirements for the competence of testing and calibration laboratories-Second editionT. ^MH8EjE hFjbpEi€EjˆEjFjpEjpEj8EjE hFjbpEj€EjˆEjFjpEj- l- General requirements for the competence of testing and calibration laboratories-Second editionT- ^MF8E 4E hF 4bpE 4€E 4ˆE 4F 4pE 4(@# soE>isturba№- and )measuri мзpparЩ]ћ;Я{ ЙOћq“?Еa@ья›К-йLјŽ:а|п‹Оj Е ^ • A У o Г _ Џ [ џЋOћŸKя›?ыƒ/ЧsОjѓŸKф!Э`џF˜йgN !a8"T/ <Corporate governance of information technology-First EditionЮ0 Mechanical vibration — Balance quality requirements for rotors in a constant (rigid) state — Part 1: Specification and verification of balance tolerances TECHNICAL CORRIGENDUM 1-Second EditionT0 РN8E 4E hF 4bpE 4€E 4ˆE 4F 4pE 4x1 Mechanical Vibration - Balance Quality Requirements of Rigid Rotors - Part 2: Balance Errors-First EditionT1 jN8E 4E hF 4bpE 4€E 4ˆE 4F 4pE 4pE 4T2 Safe Use of LasersT3 Safe Use of Lasersy4 GENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005T4 kN8E_3E hF_3bpE_3€E_3‰E_3F_3pE_3y5 GENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005T5 kN 8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3pE_3y6 GENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005T6 kN 8E34E hF34bpE34€E34ˆE34F34pE34g7 Bottom Loading and Vapor Recovery for MC-306 & DOT-406 Tank Motoq Vehicles-Eighth EditionT7 YN 8EЮ3E hFЮ3bpEЮ3€EЮ3ˆEЮ3FЮ3pEЮ3n8 Health informatics — Information security management in health using ISO/IEC 27002-First EditionT8 `N8E*4E hF*4bpE*4€E*4ˆE*4F*4pE*4n9 Health informatics — Information security management in health using ISO/IEC 27002-First EditionT9 `N8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3n: Health informatics — Information security management in health using ISO/IEC 27002-First EditionT: `N8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3pEV3n; Health informatics — Information security management in health using ISO/IEC 27002-First EditionT; `N8E"4E hF"4bpE"4€E"4ˆE"4F"4pE"4n< Health informatics — Information security management in health using ISO/IEC 27002-First EditionT< `N8E"4E hF"4bpE"4€E"4ˆE"4F"4pE"4pE"4~= Metallic materials Unified method of test for the determination of quasistatic fracture toughness-First EditionT= pN8EТE hFТbpEТ€EТˆEТFТpEТ~> Metallic materials Unified method of test for the determination of quasistatic fracture toughness-First EditionT> pN8EТE hFТbpEТ€EТˆEТFТpEТpEТ~? Metallic materials Unieied method of test for the determination of quasistatic fracture toughness-First EditionT? pN8EТE hFТbpEТ€EТˆEТFТpEТpEТ~@ Metallic materials Unified method of test for the determination of quasistatic fracture toughness-First EditionT@ pN8EТE hFТbpEТ€EТˆEТFТpEТpEТ—A Metallic materials — Unified method of test for the determination of quasistatic fracture toughness TECHNICAL CORRIEENDUM 1-First EditionTA ‰N!8EТE hFТbpEТ€EТˆEТFТpEТpEТиB Water Quality - Evaluation in an Aqueous Medium of the Ultimate Aerobic Biodegradability of Organic Compounds - Determination of Biochemical Oxygen Demand in a Two-Phase Closed Bottle Test-First EditionTB ЪN#8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3`C Environmental management - Environemental communications - Guidelines and examplesTC RN%8EЫLE hFЫLbpEЫL€EЫLˆEЫLFЫLpEЫL`D Environmental management - Environemental communications - Guidelines and examplesTD RN'8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3`E Environmental management - Environemental communications - Guidelines and examplesTE RN)8EЫLE hFЫLbpEЫL€EЫLˆEЫLFЫLpEЫLpEЫLTF >Appliance wiring material products-Second Edition; Update Mo 1~G Systems and software engineering — Requirements for designers and developers of user documentation-First EditionTG pN,8E 4E hF 4bpE 4€E 4ˆE 4F 4pE 4ƒH Information technology Security techniques Information security management systems Requirements-ISO/IEC 27001:2005TH uN.8EjE hFjbpEj€EjˆEjFjpEjoI Information technology — Security techniques — Information security!risk management-First EditionTI aN08EТE hFТbpEТ€EТˆEТFТpEТJ Information technology — Security techniques — Code of practice for information security management-First EditionTJ qN28E 4E hF 4bpE 4€E 4ˆE 4F 4pE 4K Information technology - Security techniques - Information security management systems - Requirements-First EditionTK sN48EF3E hFF3bpEF3€EE3ˆEF3FF3pEF3РL Determination of substances characteristic of green and black tea — Part 1: Content of total polyphenols in tea — Colorimetric method using Folin- Ciocalteu reagent-First editionTL ВN68EjE hFjbpEj€EjˆEjFjpEjРM Determination of substances characteristic of green and black tea — Part 1: Content of total polyphenols in tea — Colorimetric method using Folin- Ciocalteu reagent-First editionTM ВN88EjE hFjbpEj€EjˆEjFjpEjpEjРN Determination of substances characteristic of green and black tea — Part 1: Content of total polyphenols in tea — Colorimetric method using Folin- Ciocalteu reagent-First editionTN ВN:8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3РO Determination of substances characteristic of green and black tea — Part 1: Content of total polyphenols in tea — Colorimetric method using Folin- Ciocalteu!reagent-First editionTO ВN<8EjE hFjbpEj€EjˆEjFjpEjpEjзP Determination of substances characteristic of green and black tea — Part 1: Content of total polyphenols in tea — Colorimetric method using Folin-Ciocalteu reagent TECHNICAL CORRIGENDUM 1-First EditionTP ЩN>8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3pEx3РQ Determination of substances characteristic of green and black tea — Part 1: Content of total qolyphenols in tea — Colorimetric method using Folin- Ciocalteu reagent-First editionTQ ВN@8EсE hFсbpEс€EсˆEсFсpEсTR Painting, Metal PartsTS &Emergency Eyewash and Shower EquipmentT iT Reconstruction Et Reconditionnement Des Futs Pour Le Transport Des Marchandises DangereusesTT [ND8E4E hF4bpE4E4ˆE4F4pE4ВN@8EсE hFсbpEс€EсˆEсFсpEсTR Painting, Metal PartsTS &Emergency Eyewash and Shower EquipmentЋŠxv @€?ЇЇш№6б4@л2ШО пPdэЧ^ќЈT”@iUAэ-йХD№qЎZзƒБ]§ЉIѕ•Ai~ * Ќ X к †  Д 6 т t В^№œ.кlБ]фУJіЂNж‚Д`џK˜йtO Ў tU Global Qualification Process for Uncoated and Coated, Low Carbon and High Strength Sheet Steel-EnglishTU fO8E34E hF34bpE34€E34ˆE34F34pE34[V Standard Classification System for Rubber Products in Automotive ApplicationsTV MO8EjE hFjbpEj€EjˆEjFjpEjOW Standard Test Method for Peel Adhesion of Pressure-Sensitive TapeTW AO8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3RX Standard Test Methods for Shear Adhesion of Pressure-Sensitive TapesTX DO8EF4E hFF4bpEF4€EF4ˆEF4FF4pEF4TY /Structural Welding Code— Aluminum-Fifth EditionЧZ Information technology — Coding of audio-visual objects — Part 15: Advanced Video Coding (AVC) file format AMENDMENT 2: File eormat support for Scalable Video Coding (SVC)-First EditionTZ ЙO 8EсE hFсbpEс€EсˆEсFсpEсx[ Information technology - Coding of audio-visual objects - Part 15: Advanced Video Coding (AVC) file formatT[ jO 8EсE hFсbpEс€EсˆEсFсpEсpEсd\ Recommended Practices for Machinery Installation and Installation Design-First EditionT\ VO 8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3„] Standard Test Method for Linear Dimensional Changes of Nonrigid Thermoplastic Sheeting or Film at Elevated TemperatureT] vO8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3s^ Standard Test Method for Tear Strength of Conventional Vulcanized Rubber and Thermoplastic ElastomersT^ eO8E"4E hF"4bpE"4€E"4ˆE"4F"4pE"4__ Standard Test Methods for Vulcanized Rubber and Thermoplastic Emastomers— TensionT_ QO8E"4E hF"4bpE"4€E"4ˆE"4F"4pE"4pE"4T` ?Standard Test Methods for Water Vapor Transmission of MaterialsTa :Standard Test Method for Rubber Property—Effect of Liquidsrialsab Environmental management systems Requirements with guidance for use-Second EditionTb SO8EћE hFћbpEћ€EћˆEћFћpEћac Environmental management systems Requirements uith guidance for use-Second EditionTc SO8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3ad Environmental management systems Requirements with guidance for use-Second EditionTd SO8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3ae Environmental management systems Requirements with guidance for use-Second EditionTe SO8E4E hF4bpE4€E4ˆE4F4pE4cf Cylinders, spheres, and tubes for the transportation of dangerous goods-Fifth EditionTf UO8E4E hF4bpE4€E4ˆE4F4pE4pE4cg Cylinders, spheres, and tubes for the transportation of dangerous goods-Fifth EditionTg UO!8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3ch Cylinders, spheres, and tubes for the transportation of dangerous goods-Fifth EditionTh UO#8EћE hFћbpEћ€EћˆEћFћpEћpEћ“i Selection and use of cylinders, spheres, tubes, and other containers for the transportation of dangerous goods, Class 2-Fifth EditionTi …O%8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3j Gear Handbook Gear Classification, Materials and Measuring Methods for Bevel, Hypoid, Fine Pitch Wormgearing and Racks Only as Unassembled Gears (Partial Revision by 2000-A88 for Spur, Helical and Master Gears)-Errata - 1983; Replaced by ANSI/AGMA 2011-A98Tj O'8E34E hF34bpE34€E34ˆE34F34pE34Tk @Cylinder Connection Devices-Second Edition; CSA/ANSI Z21.81-2005Tl @Cylinder Connection Devices-Second Edition; CSA/ANSI Z21.81-2005Tm @Cylinder Connection Devices-Second Edition; CSA/ANSI Z21.81-2005Tn @Cylinder Connection Devices-Second Edition; CSA/ANSI Z21.81-2005To @Cylinder Connection Devices-Second Edition; CSA/ANSI Z21.81-2005Tp @Cylinder Connection Devices-Second Edition; CSA/ANSI Z21.81-2005Tq *Cylinder Connection Devices-Second Edition; CSA/ANSI Z21.81-2005yr Societal security — Guideline for incident preparedness and operational continuity management-First EditionTr kO08EћE hFћbpEћ€EћˆEћFћpEћpEћTs #Polypropylene - Recycled, CopolymerEdition; CSA/ANSI Z21.81-2005ьt Implants for surgery — Wear of total knee-joint prostieses — Part 3: Loading and displacement parameters for wear-testing machines with displacement control and corresponding environmental conditions for test-First EditionTt оO38E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3pE_3~u Systems and software engineering — Requirements for designers and developers of user documentation-First EditionTu pO58EЮ3E hFЮ3bpEЮ3€EЮ3ˆEЮ3FЮ3pEЮ3€v Information Technology - Icon Symboms and Functions for Controlling Multimedia Software Applications-First EditionTv rO78EЮ3E hFЮ3bpEЮ3€EЮ3ˆEЮ3FЮ3pEЮ3pEЮ3€w Information Technology - Icon Symbols and Functions for Controlling Multimedia Software Applications-First EditionTw rO98EТE hFТbpEТ€EТˆEТFТpEТ~x Systems and software engineering — Requirements for designers and developers of user documentation-First EditionTx pO;8E"4E hF"4bpE"4€E"4ˆE"4F"4pE"4Ty ;Standard Test Method for RubberDeterioration in an Air OvenTz 7Quality Management Systems - Requirements-Third EditionT{ -Standard Guide for Structural Sealant Glazingrd Edition‚| Standard Practice for In-Situ Measurements of Heat Flux in Industrial Thermal Insulation Using Heat Flux TransducersT| tO@8EjE hFjbpEj€EjˆEjFjpEj|} Household and similar electrical appliances - Safety - Part 2-29: Particular requirements for battery chargersT} nOB8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3pE_3Х~ Electrical apparatus for use in the presence of combustible dust – Part 10: Classification of areas where combustible dusts are or may be present-First Edition; Replaces 61241-3: 1997T~ ЗOD8E*4E hF*4bpE*4€E*4ˆE*4F*4pE*4h Remanufacturing and Reconditioning of Drums Used for the Transportation of Dangerous GoodsT ZOF8E*4E hF*4bpE*4€E*4ˆE*4F*4pE*4pE*4m€ Quality Management Systems - Aerospace - Requirements-Technically Equivalent to AECMA prEN 9100T€ _OH8EћE hFћbpEћ€EћˆEћFћpEћ v Conformity Assessment - General Requirements for Bodies Operating Certification of Persons-First EditionZOF8E*4E hF*4bpE*4€E*4ˆE*4F*4pE*4pE*4€ m€ Quality Management Systems - Aerospace - Requirements-Technically Equivalent to AECMA prEN 9100T€ _OH8EћE hFћbpEћ€EћˆEћFћpEћŽ,ПkЏъ–ЦD№œHєv"ЂNЮzќЈМh›GѓŸKїЃOћэ™В O ћ ˜ D с  , и w # Т n ЙeВ^ы—П[;t Ьz&зƒ(д`џL˜й lP5f…Ё-TзyЇHƒ hFУ3€EУ3bzEУ3ˆEУ3FУ3pEУ3•€зGeometrical Product Specifications (GPS) Geometrical tolerancing Tolerances of form, orientation, location and run-out-Second EditionT€з‡P8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3ˆзGeometrical Product Specifications (GPS) - Indication of Surface Texture in Technical Product Documentation-Fourth EditionTзzP8E04E hF04bpE04€E04ˆE04F04pE04pE04g‚зTechnical Drawings - Edges of Undefined Shape - Vocabulary and Indications-Second EditionT‚зYP8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3Tƒз;Quality management systems — Requirements-Quatriшme щditiones_T„з8Quality Management Systems - Requirements-Fourth EditionХ…зRepresentation of results of particle size analysis - Part 5: Methods of calculation relating to particle size analyses using logarithmic normal probability distribution-First EditionT…зЗP 8EZ3E hFZ3bpEZ3€EZ3ˆEZ3FZ3pEZ3v†зInformation and documentation - Records management processes - Metadata for records - Part 1: PrinciplesT†зhP 8EђE hFђbpEђ€EђˆEђFђpEђpEђ‡зInformation and documentation - Records management!processes - Metadata for records - Part 2: Conceptual and implementation issuesT‡з‚P 8EњE hFњbpEњ€EњˆEњFњpEњ`ˆзInformation and Documentation - Records Management - Part 1: General-First EditionTˆзRP8EђE hFђbpEђ€EђˆEђFђpEђpEђz‰зDocument management — Engineering document format using PDF — Part 1: Use of PDF 1.6 (PDF/E-1)-First EditionT‰зlP8EJ4E hFI4bpEJ4€EJ4ˆEJ4FJ4pEJ4zŠзDocument management — Engineering document format using PDF — Part 1: Use of PDF 1.6 (PDF/E-1)-First EditionTŠзlP8EђE hFђbpEђ€EђˆEђFђpEђpEђz‹зDocument management — Engineering document format using PDF — Part 1: Use of PDF 1.6 (PDF/E-1)-First EditionT‹зlP8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3pEУ3zŒзDocument management — Engineering document formau using PDF — Part 1: Use of PDF 1.6 (PDF/E-1)-First EditionTŒзlP8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3pEУ3zзDocument management — Engineering document format using PDF — Part 1: Use of PDF 1.6 (PDF/E-1)-First EditionTзlP8Eb3E hFb3bpEb3€Eb3ˆEb3Fb3pEb3VŽзNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TŽзHP8EZ3E hFZ3bpEZ3€EZ3ˆEZ3FZ3pEZ3VзNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TзHP8ER3E hFR3bpER3€ER3ˆER3FR3pER3VзNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TзHP8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3ќ‘зSeries 1 freight containers Specification and testing Part 1: General cargo containers for general purposes-Fifth Edition; Amendment 1: 03/01/93; Amendment 2: 07/01/98; Amendment 3: 06/15/05; Amendment 5: 05/15/06; Amendment 4: 11/01/06T‘зюP!8ER3E hFR3bpER3€ER3ˆER3FR3pER3pER3ќ’зSeries 1 freight containers Specification and testing Part 1: General cargo containers for general purposes-Fifth Edition; Amendment 1: 03/01/93; Amendment 2: 07/01/98; Amendment 3: 06/15/05; Amendment 5: 05/15/06; Amendment 4: 11/01/06T’зюP#8EZ3E hFZ3bpEZ3€EZ3ˆEZ3FZ3pEZ3pEZ3V“зNAS Certification & Qualification of Nondestructive Test Personnel-REV 3T“зHP%8EZ3E hFZ3bpEZ3€EZ3ˆEZ3FZ3pEZ3pEZ3…”зStandard Test Method for Determining Aerobic Biodegradation of Plastic Materials under Controlled Composting ConditionsT”зwP'8EїME hFїMbpEїM€EїMˆEїMFїMpEїMž•зProficiency Testing by Interlaboratory Comparisions - Part 1: Development and Operation of Laboratory Proficiency Testing Schemes-Second EditionT•зP)8EџME hFџMbpEџM€EџMˆEџMFџMpEџMT–з;Quality management systems — Requirements-Quatriшme щditionT—з8Quality Management Systems - Requirements-Fourth Edition џ4z˜зStandard Specification for Biodegradable Plastics Used as Coatings on Paper and Other Compostable SubstratesT˜зlP-8EЯME hFЯMbpEЯM€EЯMˆEЯMFЯMpEЯMT™з;Qualiuy management systems — Requirements-Quatriшme щditionQšзInformation technology - Service management - Part 1: SpecificationTšзCP08EїME hFїMbpEїM€EїMˆEїMFїMpEїMpEїMZ›зGraphical Symbols for Electrical Equipment in Medical Practice First EditionT›зLP28Eb3E hFb3bpEb3€Eb3ˆEb3Fb3pEb3Tœз TOWEL, HAND, GREEN, HUCK, COTTONTз8Quality Mamagement Systems - Requirements-Fourth EditionmžзAnalysis of blood for asphyxiant toxicants — Carbon monoxide and hydrogen cyanide-First EditionTžз_P68E‡ME hF‡MbpE‡M€E‡MˆE‡MF‡MpE‡MmŸзAnalysis of blood for asphyxiant toxicants — Carbon monoxide and hydrogen cyanide-First EditionTŸз_P88EME hFMbpEM€EMˆEMFMpEMo зSecurity management systems for the supply chain — Guidelimes for the implementation of ISO 28000T зaP:8EME hFMbpEM€EMˆEMFMpEMpEM}ЁзSecurity management systems for the supply chain — Guidelines for the implementation of ISO 28000-First EditionTЁзoP<8EЏME hFЏMbpEЏM€EЏMˆEЏMFЏMpEЏMPЂзSpecification for security management systems for the supply chainTЂзBP>8EME hFMbpEM€EMˆEMFMpEMpEMmЃзAnalysis of blood for asphyxiant toxicants — Carbon monoxide and hydrogen cyanide-First EditionTЃз_P@8Eb3E hFb3bpEb3€Eb3ˆEb3Fb3pEb3pEb3TЄз?Qualification test of welders - Fusion welding - Part 1: SteelscЅзQualification test of welders - Fusion welding - Part 1: Steels (ISO/DIS 9606-1:2008)TЅзUPC8EѕME hFѕMbpEѕM€EѕMˆEѕMFѕMpEѕMRІзQuality Management and Quality Assurance - Vocabulary-Qecond EditionTІзDPE8ENE hFNbpEN€ENˆENFNpENpENRЇзQuality Management and Quality Assurance - Vocabulary-Second EditionTЇзDPG8EЏME hFЏMbpEЏM€EЏMˆEЏMFЏMpEЏMpEЏMrЈзUltrasonic testing of steel flat product of thickness equal or greater than 6 mm (reflection method)TЈзdPI8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3Љз‘ЉзTank Inspection, Repaiq, Alteration, and Reconstruction-Third Edition; ADD 1: 9/2003; ADD 2: 11/2005; ADD 3: 2/2008; Errata: 4/2008itionTЇзDPG8EЏME hFЏMbpEЏM€EЏMˆEЏMFЏMpEЏMpEЏMЈзrЈзUltrasonic testing of steel flat product of thickness equal or greater than 6 mm (reflection method){NCNZHBAAAAAAAAAAZ432-04 лyГa ЛgА\я›Kїz&ЗcіЂ5с9п‹:ц’Фp~*ЅQћЇЋW[  Б ]  Г ]  ; С m ѓŸ%бWЃOПkѕЁмˆ4рy%IД`џE˜йbQ7м92TЉзƒPKƒ hFN€ENbzENˆENFNpENpENTЊз;Quality management systems — Requirements-Quatriшme щditionTЋз8Quality Management Systems - Requirements-Fourth Edition]ЌзMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TЌзOQ8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3pEУ3T­з*Electronic Records as Documentary Evidence]ЎзMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TЎзOQ8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3pEУ3ЏзDocument management - Electronic document file format for long-term preservation - Part 1: Use of PDF 1.4 (PDF/A-1)TЏзsQ8EЖLE hFЖLbpEЖL€EЖLˆEЖLFЖLpEЖLgАзOverhead tqavelling cranes — Design, inspection, testing, maintenance, and safe operationTАзYQ 8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3\БзConstruction and Test of Electric Cranes and Hoists-General Instruction No 1-2TБзNQ 8EZ3E hFZ3bpEZ3€EZ3ˆEZ3FZ3pEZ3ъВзGuidelines for quality and/or environmental management systems auditing-ISO 19011:2002; Supersedes AS 3911.1, NZS 10011.1, AS 3911.2,NZS 10011.2, AS 3911.3, NZQ 10011.3, AS/NZS ISO 14010,AS/NZS ISO 14011 AND AS/NZS 14012TВзмQ8EђE hFђbpEђ€EђˆEђFђpEђTГз<Cranes - Training of Drivers - Part 1: General First EditionTДз8Quality Management Systems - Requirements-Fourth EditionTЕз8Quality Management Systems - Requirements-Fourth Edition ЖзCharacterisation of waste - Leaching - Compliance test for leaching of granular waste materials and smudges - Part 2: One stage batch test at a liquid to solid ratio of 10 l/kg for materials with particle size below 4 mm (without or with size reduction)TЖз§Q8EZ3E hFZ3bpEZ3€EZ3ˆEZ3FZ3pEZ3pEZ3 ЗзCharacterisation of waste - Leaching - Compliance test for leaching of granular waste materials and sludges - Part 2: One stage batch test at a liquid to solid ratio of 10 l/kg for materials with particle size below 4 mm (without or with size reduction)TЗз§Q8EZ3E hFZ3bpEZ3€EZ3ˆEZ3FZ3pEZ3pEZ3 ИзCharacterisation of waste - Leaching - Compliance test for leaching of granular waste materials and sludges - Part 2: One stage batch test at a liquid to solid ratio of 10 l/kg for materials with particle size below 4 mm (without or with size reduction)TИз§Q8E'ME hF'MbpE'M€E'MˆE'MF'MpE'MЉЙзTesting of concrete Part 2: Properties of fresh concrete-First Edition;!Replaces ISO 4109:1980, ISO 4110:1979, ISO 4111:1979, ISO 4848:1980, ISO 6276:1982TЙз›Q8EwME hFwMbpEwM€EwMˆEwMFwMpEwMPКзStandard Specification for Rigid Poly(Vinyl Chloride) (PVC) SidingTКзBQ8EЧME hFЧMbpEЧM€EЧMˆEЧMFЧMpEЧM€ЛзStandard Specification for Rigid Poly(Vinyl Chloride) (PVC) Siding with Foam Plastic Backing (Backed Vinyl Siding)TЛзrQ8EђE hFђbpEђ€EђˆEђFђpEђpEђЫМзSelection and Use of Highway Tanks, Portable Tanks, Cargo Compartments, and Containers for the Transportation of Dangerous Goods, Classes 3, 4, 5, 6.1, 8, and 9-Third Edition; Update No 1-2TМзНQ8EђE hFђbpEђ€EђˆEђFђpEђpEђoНзInformation technology — Security techniques — Information security risk management-First EditionTНзaQ!8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4€ОзWater analysis - Guidelines for the determination of total organic carbon (TOC) and dissolved organic carbon (DOC)TОзrQ#8EђE hFђbpEђ€EђˆEђFђpEђpEђ€ПзWater analysis - Guidelines for the determination of total organic carbon (TOC) and dissolved organic carbon (DOC)TПзrQ%8EђE hFђbpEђ€EђˆEђFђpEђpEђ•РзInformation and documentation Guidelines for standards drafters for statimg records management requirements in standards-ISO 22310:2006TРз‡Q'8ENE hFNbpEN€ENˆENFNpEN‰СзInformation and documentation Records management processes Metadata for records Part 1: Principles-Same as ISO 23081-1:2006TСз{Q)8ENE hFNbpEN€ENˆENFNpENpENТзInformation and documentation - Records management processes - Metadata for records - Part 2: Conceptual and implementation issuesTТз‚Q+8ER3E hFR3bpER3€ER3ˆER3FR3pER3fУзDocumentation. Guidelines for the establishment and development of multilingual thesauriTУзXQ-8ENE hFNbpEN€ENˆENFNpENpENФзDocument management - Electronic document file format for long-term preservation - Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionTФзQ/8EяLE hFяLbpEяL€EяLˆEяLFяLpEяLХзDoaument management — Electronic document file format for long-term preservation — Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionTХзQ18Eb3E hFb3bpEb3€Eb3ˆEb3Fb3pEb3OЦзInformation and documentation - Work process analysis for recordsTЦзAQ38Eb3E hFb3bpEb3€Eb3ˆEb3Fb3pEb3pEb3VЧзFiber Glass Reinforced Polymer Materials-Includes Appendix December 2003TЧзHQ58ER3E hFR3bqER3€ER3ˆER3FR3pER3pER3ЊШзCells, Tissues, and Organs for Transplantation and Assisted Reproduction: General Requirements-First Edition: Update No 1: May 2003; Update No 2: March 2007TШзœQ78EзME hFзMbpEзM€EзMˆEзMFзMpEзMTЩз?Human Factors Design Process for Medical Devices-FDA RECOGNIZED_{ЪзAnalysis techniques for system reliability – Procedure for failure mode and effects analysis (FMEA)-Edition 2TЪзmQ:8EY3E hFY3bpEY3€EY3ˆEY3FY3pEY3TЫз?Human Factors Design Process for Medical Devices-FDA RECOGNIZEDTЬз@Sampling Procedures and Tables for Inspection by Attributes-T004ЌЭзSampling Procedures for Inspection by Attributes - Part 1: Sampling Schemes Indexed by Acceptance Quality Limit (AQL) for Lot-by-Lot Inspection-Second EditionTЭзžQ>8ELE hFLbpEL€ELˆELFLpELpEL{ЮзMeasurememt Management Systems - Requirements for Measurement Processes and Measuring Equipment-First EditionTЮзmQ@8EY3E hFY3bpEY3€EY3ˆEY3FY3pEY3pEY3TЯз=Graphical symbols for use in the labelling of medical devices004ЕазMedical devices Symbols to be used with medical device labels, labelling and information to be supplied-First Edition: Amendment 1: 8/01/2002; Amendment 2: 02/15/2004TазЇQC8EME hFMbpEM€EMˆEMFMpEMhFY3bpEY3€EY3ˆEY3FY3pEY3pEY3TЯз=Graphical symbols for use in the labelling of medical devices004азЕазMedical devices Symbols to be used with medical device labels, labelling and information to be supplied-First Edition: Amendment 1: 8/01/2002; Amendment 2: 02/15/2004-CURREN чиŸf-єЛ‚IР Зcш”ш”@ьqЩЫu!в~я› ИRўn‘=ЈTд€Ќ=щЪ J і І R Љ U J і ы—Œ8ф<RўЂNч“Оa Й\Д`џH˜йŠєR7гЮ'iбзStandard Guide for Design and Evaluation of Primary Flexible Packaging for Medical ProductsTбз[R8EњE hFњbpEњ€EњˆEњFњpEњpEњuвзPackaging Requirements for the use of European Standards in the field of packaging and packaging wasteTвзgR8EME hFMbpEM€EMˆEMFMpEMpEMoгзPackaging Requirements specific to manufacturing and composition Prevention by source reductionTгзaR8EME hFMbpEM€EMˆEMFMpEMpEMTдзPackaging ReuseUезPackaging Requirements for packaging recoverable by material recyclingTезGR8ELE hFLbpEL€ELˆELFLpELpEL›жзPackaging Requirements for packaging recoverable in the form of energy recnvery, including specification of minimum inferior calorific valueTжзR 8EME hFMbpEM€EMˆEMFMpEMpEMЫззPackaging - Requirements for Packaging Recoverable Through Composting and Biodegradation - Test Scheme and Evaluation Criteria for the Final Acceptance of Packaging-CORR 17016: May 31, 2007TззНR 8EME hFMbpEM€EMˆEMFMpEMpEMTиз;Quality management systems — Requirements-Quatriшme щdivionTйз8Quality Management Systems - Requirements-Fourth EditionOGNIZED_Tкз8Quality Management Systems - Requirements-Fourth EditionOGNIZEDTлз;Quality management systems — Requirements-Quatriшme щdition‰мзAnimal tissues and their derivatives utilized in the manufacture of medical devices Part 1: Analysis and management of riskTмз{R8ELE hFLbpEL€ELˆELFLpELpELTнз!PLATFORM, NVERHEAD WORK, FORKLIFTvозPackaging - Requirements for the use of European Standards in the field of packaging and packaging wasteTозhR8Ea3E hFa3bpEa3€Ea3ˆEa3Fa3pEa3oпзAnalysis techniques for system reliability—Procedure for failure mode and effects analysis (FMEA)TпзaR8EY3E hFY3bpEY3€EY3ˆEY3FY3pEY3Tрз?Human Factors Design Process for Medical Fevices-FDA RECOGNIZEDTсз@Sampling Procedures and Tables for Inspection by Attributes-T004~тзMeasurement management systems - Requirements for measurement processes and measuring equipment (ISO 10012:2003)TтзpR8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3Tуз3Symbols for use in the labelling of medical devicestributes-T004ЕфзMedical devices Symbols to be used with medical device labels, labelling and information to be svpplied-First Edition: Amendment 1: 8/01/2002; Amendment 2: 02/15/2004TфзЇR8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4iхзStandard Guide for Design and Evaluation of Primary Flexible Packaging for Medical ProductsTхз[R8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3{цзAnalysis techniques for system reliability – Procedure for failure mode and effects analysis (FMEA)-Edition 2TцзmR!8Ey3E hFz3bpEy3€Ey3ˆEy3Fy3pEy3pEy3ЌчзSampling Procedures for Inspection by Attributes - Part 1: Sampling Schemes Indexed by Acceptance Quality Limit (AQL) for Lot-by-Lot Inspection-Second EditionTчзžR#8Ea3E hFa3bpEa3€Ea3ˆEa3Fa3pEa3pEa3{шзMeasurement Management Systems - Requirements for Measurement Processes and Measuring Equipment-First EditionTшзmR%8ELE hFLbpEL€ELˆELFLpELpELTщз=Graphical symbols for use in the labelling of medical devicesvъзPackaging - Requirements for the use of European Standards in the field of packaging and packaging wasteTъзhR(8E04E hF04bpE04€E04ˆE04F04pE04uызPackaging Requirements for the use of European Standards in the field of packaging and packaging wasteTызgR*8E04E hF04bpE04€E04ˆE04F04pE04pE04oьзPackaging Requirementr specific to manufacturing and composition Prevention by source reductionTьзaR,8E04E hF04bpE04€E04ˆE04F04pE04pE04TэзPackaging Reusein the labelling of medical devicestributes-T004UюзPackaging Requirements for packaging recoverable by material recyclingTюзGR/8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3jязStandard Practice for Conditioning Containers, Packages, or Packaging Components for TfstingTяз\R18Ea3E hFa3bpEa3€Ea3ˆEa3Fa3pEa3pEa3œ№зPackaging - Requirements for packaging recoverable in the form of energy recovery, including specification of minimum inferior calorific valueT№зŽR38EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4ЫёзPackaging - Requirements for Packaging Recoverable Through Composting and Biodegradation - Test Scheme and Evaluation Criteria for the Final Acceptance of Packaging-CORR 17016: May 31, 2007TёзНR58E04E hF04bpE04€E04ˆE04F04pE04pE04wђзClinical Investigation of Medical Devices for Human Subjects - Part 1: General Requirements-First EditionTђзiR78E04E hF04bpE04€E04ˆE04F04pE04pE04ЬѓзClinical Investigation of Medical Devices for Human Subjects - Part 2: Clinical Investigation Plans-First Edition; Together with the first edition of 14155-1 Cancels and Replaces 14155: 1996 TѓзОR98EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4pEJ4QєзMedical device software – Software life cycle processes-Edition 1.0TєзCR;8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4pEJ4дѕзMedical Electrical Equipment - Part 1-4: General Requirements for Safety - Collateral Standard: Programmable Electrical Medical Systems-Edition 1.1; Edition 1:1996 Consolidated with Amendment 1:1999TѕзЦR=8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4pEJ4–ізUL Standard for Safety Software in Programmable Components-Second Edition; Reprint with Revisions through and Including October 28, 2008TізˆR?8Ea3E hFa3bpEa3€Ea3ˆEa3Fa3pEa3pEa3TїзDeveloping a Software Project Life Cycle Process-IEEE Computer SocietyTїзFRA8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4pEJ4„јзGeneral requirements for the competence of testing and calibratjon laboratories TECHNICAL CORRIGENDUM 1-Second editionTјзvRC8ELE hFLbpEL€ELˆELFLpELpEL„љзGeneral requirements for the competence of testing and calibration laboratories TECHNICAL CORRIGENDUM 1-Second editionTљзvRE8E04E hF04bpE04€E04ˆE04F04pE04pE04њз„њзGeneral requirements for the competence of testing and calibration laboratories TECHNICAL CORRIGENDUM 1-Second edition€ELˆELFLpELpELљз„љзGeneral requirements for the competence of testing and calibration laboratories TECHNICAL CORRIGENDUM 1-Second editionTљзvRE8E04E hF04bpE04€E04ˆE04F04pE04pE04AAAAAAAC-5 `HCCGAACTV-CURREN@ Р(№?ШО ИАЅ(d?А(pћ(шћ(Ш>А(pŠ6В^ Ж ЬјЄSџ3пhIѕY›GђžJл‡ОHє %б%б V  ™ E  < ш j  Т n џЋ5сА\Д`•AІR§ЉUц’Щ`џN˜йŠшS9 TњзvRGƒ hFJ4€EJ4bzEJ4ˆEJ4FJ4pEJ4pEJ4eћзQuality Management Systems - Requirements for Aviation, Space and Defense OrganizationsTћзWS8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4pEJ4Tќз=Graphical symbols for use in the labelling of medical devices004g§зSampling Procedures and Tables for Inspection by Variables for Percent Nonconforming-T009T§зYS8Ea3E hFa3bpEa3€Ea3ˆEa3Fa3pEa3pEa3gўзSampling Procedures and Tables for Inspection by Variables for Percent Nonconforming-T009TўзYS8EY3E hFY3bpEY3€EY3ˆEY3FY3pEY3pEY3Tџз8Quality Management Systems - Requirements-Fourth EditionuиDocumentation - Guidelines for the Establishment and Development of Monolingual Thesauri Second EditiomTиgS 8ELE hFLbpEL€ELˆELFLpELpELSиGeographic information - Data product specifications (ISO 19131:2007)TиES 8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3SиGeographic information - Data product specifications (ISO 19131:2007)TиES 8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3SиGeographic information - Data product specifications (ISO 19131:2007)TиES8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3SиGeographic information - Data product specifications (ISO 19131:2007)TиES8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4pEJ4SиGeographic information - Data product specifications (ISO 19131:2007)TиES8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3‡иAgricultural wheeled tractors — Rear-mounted three-point linkage — Categories 1N, 1, 2N, 2- 3N, 3, 4N and 4-First EditionTиyS8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4pEJ4”иAgricultural tractors and machinery — Connection of implements via three-point linkage — Clearance zone around implement-Third EditionTи†S8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3миTractors, machinery for agriculture and forestry, powered lawn and garden equipment — Symbols for operator controls and other displays — Part 2: Symbolq for agricultural tractors and machinery-Third EditionTиЮS8ELE hFLbpEL€ELˆELFLpELpELŒ иElectrical equipment for measurement, control and laboratory use – EMC requirements – Part 1: General requirements-Edition 1.0T и~S8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3T и=Information Supplied by the Manufacturer with Medical Devicess_T и=Information Supplied by the Manufacturer with!Medical DevicesT и%Medical supply units (ISO 11197:2004)lling of medical devices004‹ иAnimal tissues and their derivatives utilized in the manufacture of medical devices - Part 1: Analysis and management of riskT и}S 8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3™иAnimal tissues and their derivatives utilized in the manufacture of medical devices - Part 2: Controls on sourcing, collection and handlingTи‹S"8Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3СиAnimal tissues and their derivatives utilized in the manufacture of medical devices - Part 3: Validation of the elimination and/or inactivation of viruses and transmissible agentsTиГS$8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3_иMethods of Sampling and Testing Cordage Diameter-Supersedes 40-GP-1; October 1953TиQS&8EђE hFђbpEђ€EђˆEђFђpEђpEђTиInspection Material, PenetrantTиInspection Material, Penetrantnufacturer with Medical DevicesTиInspection Material, PenetrantTиInspection Material, Penetrantnufacturer with Medical DevicesTиInspection Material, PenetrantTи;Quality management systems — Requirements-Quatriшme щditionTи;Quality management systems — Requirements-Quatriшme щditionTи;Quality management systems — Requirements-Quatriшme щditionesTи;Quality management systems — Requirements-Quatriшme щditionzиTest sieves - Technical requirements and testing - Part 1: Test sieves of metal wire cloth (ISO 3310-1:2000)TиlS18ELE hFLbpEL€ELˆELFLpEL{иTest sieves - Technical requirements and testing - Paqt 2: Test sieves of perforated plates (ISO 3310-2:1999)TиmS38EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4‡иTest sieves - Metal wire cloth, perforated metal plate and electroformed sheet - Nominal sizes of openings (ISO 565:1990)TиyS58Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3ZиFresh Concrete - Determination of the Consistency - Slump Test First EditionTиLS78E1LE hF1LbpE1L€E1LˆE1MF1LpE1LpE1LnиCode of Practice for Safety in Demolition of Structures-First Edition; General Instruction No. 1Tи`S98Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3Tи@GUIDELINES FOR CORRECTIVE ACTION-Same as ISO/IEC Guide 27 : 1983T иQuality Management Systems - Fundamentals and Vocabulary-Third EditionT иFS<8E04E hF04bpE04€E04ˆE04F04pE04pE04n!иCode of Practice for Safety in Eemolition of Structures-First Edition; General Instruction No. 1T!и`S>8Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3„"иGeneral requirements for the competence of testing and calibration laboratories TECHNICAL CORRIGENDUM 1-Second editionT"иvS@8E04E hF04bpE04€E04ˆE04F04pE04pE04„#иGeneral requirements for the competence of testing and calibration laboratories TECHNICAL CORRIGENDUM 1-Second editionT#иvSB8E1LE hF1LbpE1L€E1LˆE1LF1LpE1LpE1Lj$иPLATES, IDENTIFICATION OR INSTRUCTION, METAL FOIL, ADHESIVE BACKED GENERAL SPECIFICATION FORT$и\SD8EЦLE hFЦLbpEЦL€EЦLˆEЦLFЦLpEЦLT%и0IDENTIFICATION MARKING OF U.S. MILITARY PROPERTYT&и;Quality management systems — Requirements-Quatriшme щditionT'и8Quality Management Systems - Requirements-Fourth Editionies_T(и4Geographic information Spatial schema-First Editiontionies_T)и8Quality Management Systems - Requirements-Fourth Edition€*иGlass in Building - Laminated Glass and Laminated Safety Glass - Part 4: Test Methods for Durability-First EditionT*иrSK8E NE hF NbpE N€E NˆE NF NpE N+и`+иRESTRICTED SUBSTANCE MANAGEMENT STANDARD ***TO BE USED WITH FORD WSS-M99P1111-A***nagement Systems - Requirements-Fourth Edition*и€*иGlass in Building - Laminated Glass and Laminated Safety Glass - Part 4: Test Methods for Durability-First EditionT*иrSK8E NE hF NbpE N€E NˆE NF NpE N=ELECISOACTV-CURRENП6нВХO(oќ6PU 7П6HП6(П6нВХOрnќ6јV 70П6`П6@П6нВХO˜nќ6ˆW 7HП6ˆ&ІRўЊVЎD№l”@в~*ж‚Рf‹7МhюšFђžJіЂNњІGѓ2о E ё f  О j  Š 6 Z  r—C№œIѕЂNћЇT‹7у|(СmД`џL˜йtT<ŽК0T+иRSMƒ hF N€E NbzE NˆE NF NpE NpE NT,и"Metal Stairs Manual; Fifth Edition€?Ccategories_T-и"Metal Stairs Manual; Fifth Editionrements-Quatriшme щditionT.и"Metal Stairs Manual; Fifth Edition€?€?€?Z=T/и"Metal Stairs Manual; Fifth Edition€?€?€?Z=e0иQuality Management Systems - Requirements for Aviation, Space and Defense OrganizationsT0иWT8E8ME hF8MbpE8M€E8MˆE8MF8MpE8MpE8Me1иQuality Management Systems - Requirements for Aviation, Space and Defense OrganizationsT1иWT8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3T2и5Cranes - Inspections - Part 1: General-Second Editionh3иCranes Wire ropes Care, maintenance, jnstallation, examination and discard-Third EditionT3иZT 8E0NE hF0NbpE0N€E0NˆE0NF0NpE0Nv4иCranes — Wire ropes — Care, maintenance, installation, examination and discard AMENDMENT 1-Third EditionT4иhT 8E NE hF NbpE N€E NˆE NF NpE NpE N}5иRound wire concentric lay overhead electrical stranded conductors-First Edition; CEI/IEC 1089:1991; Update No 1T5иoT8E1LE hF1LbpE1L€E1LˆE1LF1LpE1LT6и0Acoustical Terminology-Erratum: 12/2005; ASA 111egories_n7иSpecification for Octave-Band and Fractional-Octave-Band Analog and Digital Filters-Errata: 2005T7и`T8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3T8и@Specifications and Verification Procedures for Sound Calibrators_9иSpecification for Sound Level Meters-ASA 47 - 1983; Includes Amendment S1.4a-1985T9иQT8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3pEУ3Y:иMethod for Calculation of the Absorption of Sound by the Atmosphere-ASA 113T:иKT8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3pEУ3T;и+Measurement of Sound Pressure Levels in AirO<иStandard Guide for Measurement of Outdoor A-Weighted Sound LevelsT<иAT8E№E hF№bpE№€E№ˆE№F№pE№[=иStandard Guide for Selection of Environmental Noise Measurements and CriteriaT=иMT8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3›>иAcoustics - Attenuation of Sound During Propagation Outdoors - Part 1: Calculation of the Absorption of Sound by the Atmosphere First EditionT>иT8Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3pEq3€?иAcoustics - Attenuation of Sound During Propagation Outdoors - Part 2: General Method of Calculation-First EditionT?иrT8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3pEУ3ˆ@иElectroacoustics - Sound Level Meters - Part 1: Specifications-First Edition; Replaces IEC 60651: 2000 and IEC 60804: 2000T@иzT!8E№E hF№bpE№€E№ˆE№F№pE№pE№ЈAиElectroacoustics - Octave-Band and Fractional-Octave-Band Filters-First Edition; CENELEC EN 61 260: 1995; Supersedes IEC 60225: 1966; Amendment 1: 09 2001TAиšT#8EP2E hFP3bpEP3€EP3ˆEP3FP3pEP3pEP3’BиElectroacoustics Sound level meters Part 2: Pattern evaluation tests-First Edition; Replaces IEC 60651: 2000 and IEC 60804: 2000TBи„T%8Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3pEq3XCиElectroacoustics – Sound level meters – Part 3: Periodic tests-Edition 1.0TCиJT'8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3pEP3DиRecommended Practice for the Prediction of Sound Levels Received at a Distance from an Industrial Plant-First Edition; General Instruction No 1TDиT)8Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3pEq3oEиInformation technology — Security techniques — Information security risk management-First EditionTEиaT+8ELE hFLbpEL€ELˆELFLpELaFиInformation technology - Security techniques - Information security risk managementTFиST-8EјE jFјbpEј€EјˆEјFјpEјaGиInformation technology - Security techniques - Information security risk managementTGиST/8Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3XHиISO 14000 SERIES - ENVIRONMENTAL COLLECTION-SEE ALSO ISO 9000 AND 14000 CDTHиJT18Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3ЁIиAutomation systems in the process industry – Factory acceptance test (FAT), site acceptance test (SAT), and site integration test (SIT)-Edition 1.0TIи“T38E0LE hF0LbpE0L€E0LˆE0LF0LpE0L”JиAutomation systems in the process industry - Factory acceptance test (FAT), site acceptance test (SAT) and site integration test (SIT)TJи†T58E0LE hF0LbpE0L€E0LˆE0LF0LpE0LpE0LTKи3Doors, Mirrored Glass, Sliding or Folding, WardrobeTLи3Doors, Mirrored Glass, Sliding or Folding, WardrobfzMиStandard Practice for Installation of Metal Ceiling Suspension Systems for Acoustical Tile and Lay-In PanelsTMиlT98EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3TNи=Occupational Safety Code for Diving Operations-Fourth EditionTOи.Occupational safety code for diving operations-Fourth EditionhPиCompressed Breathing Air and Systems-Fourth Edition; General Instruction No 1; Update No 2TPиZT=8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3pEP3шQиConformity assessment General requirements for accreditation bodies accrediting conformity assessment bodies-First Edition; Corrected Version 2/15/2005; Replaces ISO Guide 58:1993, ISO Guide 61:1996, ISO TR 17010:1998TQикT?8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓoRиPaper and Board - Determination of CIE Whiteness, D65/10 Degree (Outdoor Daylight)-Second EditionTRиaTA8EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3pEЖ3‰SиEarth-moving machinery - Falling-object protective structures - Laboratory tests and performance requirements-Fifth EditionTSи{TC8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3TTи3Geographic informationSpatial schema-ISO 19107:2003gories_TUи*Electronic Records as Documentary Evidenceions-Fourth EditionTVи"Sheathing, Membrane, Breather Type€?€?€?TWи*Electronic Records as Documentary Evidence9107:2003gories_іXиThermometers for measuring the air and product temperature for the transport, storage and distribution of chilled, frozen, deep-frozen/quick-frozen food and ice cream - Test, performance, suitability; English version of DIN EN 13485TXишTI8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓYиБYиTemperature recorders for the transport, storafe and distribution of chilled, frozen, deep-frozen/quick-frozen food and ice cream - Tests, performance, suitabilityof chilled, frozen, deep-frozen/quick-frozen food and ice cream - Test, performance, suitability; English version of DIN EN 13485TXишTI8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓc%ELECISOACTV-CURRУakУoЧ>ъ{'?ыƒ/л‡ Йe})ˆ4мˆ'гrЏ[ОjО,и 0 м T € , ‘ = т Ž ? ы—>ъ‹7уu!ЭPќ†2Ъv"НiА\Д`џP˜йoёU?G`’рTYиЃTKƒ hFЫ3€EЫ3bzEЫ3ˆEЫ3FЫ3pEЫ3kZиNon-destructive testing of welds Penetrant testing of welds Acceptance levels-First EditionTZи]U8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3a[иNon-destructive testing of welds Ultrasonic testing of welded joints-First EditionT[иSU8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓZ\иDestructive Tests on Welds in Metallic Materials - Bend Tests-Second EditionT\иLU8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3~]иDestructive tests on welds in metallic materials Macroscopic and microscopic examination of welds-First editionT]иpU8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3T^и*Electronic Records as Documentary EvidenceT_и*Electronic Records as Documentary EvidenceT`и*Electronic Records as Documentary Evidence]aиMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TaиOU 8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3pEP3Tbи8Quality Management Systems - Requirements-Fourth EditionTcи8Quality Management Systems - Requirements-Fourth EditionŽdиStandard Practice for Rehabilitation of Existing Pipelines and Conduits by the Inversion and Curing of a Resin-Impregnated TubeTdиU8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3pEP3Teи8Quality Management Systems - Requirements-Fourth EditionTfи8Quality Management Systems - Requirements-Fourth Edition~gиStandard Practice for Visual Appraisal of Colors and Color Differences of Diffusely-Illuminated Opaque MaterialsTgиpU8EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3~hиStandard Practice for Visual Appraisal of Colors and Color Differences of Diffusely-Illuminated Opaque MaterialsThиpU8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3[iиStandard Practice for Computing the Colors of Objects by Using the CIE SystemTiиMU8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓkjиTrunking Control Channel"Messages- Radio Unit Monitor Enhancements-Addendum to TIA-102.AABC-BTjи]U8EЪLE hFЪLbpEЪL€EЪLˆEЪLFЪLpEЪLpEЪLTkи!Requirements for Soldering FluxesTlи!Requirements for Soldering FluxesZmиExplosive atmospheres – Part 0: Equipment – General requirements-Edition 5.0TmиLU8EЪLE hFЪLbpEЪL€EЪLˆEЪLFЪLpEЪLknиExpnosive atmospheres – Part 1: Equipment protection by flameproof enclosures “d”-Edition 6.0Tnи]U 8EЪLE hFЪLbpEЪL€EЪLˆEЪLFЪLpEЪLpEЪLhoиExplosive atmospheres – Part 19: Equipment repair, overhaul and reclamation-Second EditionToиZU"8EПE hFПbpEП€EПˆEПFПpEПkpиExplosive atmospheres – Part 2: Equipment protection by pressurized enclosure ЋpЛ-Edition 5.0Tpи]U$8EK4E hFK4bpEK4€EK4ˆEK4FK4pEK4kqиExplosive atmospheres – Part 1: Equipment protection by flameproof enclosures “d”-Edition 6.0Tqи]U&8EПE hFПbpEП€EПˆEПFПpEПpEПnrиMicrographic examination of the non-metallic inclusion content of steels using standard picturesTrи`U(8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓosиMicrographic examination of the non- metallic inclusion content of steelr using standard picturesTsиaU*8E04E hF04bpE04€E04ˆE04F04pE04ltиGeneral requirements for the competence of testing and calibration laboratories-Second editionTtи^U,8EX3E hFX3bpEX3€EX3ˆEX3FX3pEX3luиGeneral requirements for the competence of testing and calibration laboratories-Second editionTuи^U.8E1LE hF1LbpE1L€E1LˆE1LF1LpE1LdvиWater"Vapor Transmission Rate of Paper and Paperboard at High Temperature and HumidityTvиVU08EџLE hFџLbpEџL€EџLˆEџLFџLpEџLdwиWater Vapor Transmission Rate of Paper and Paperboard at High Temperature and HumidityTwиVU28EћE hFћbpEћ€EћˆEћFћpEћ{xиNORTH ATLANTIC TREATY ORGANIZATION MILITARY AGENCY FOR STANDARDIZATION (MAS) NATO LETTER OF PROMULGATION-ED 1TxиmU48EЉMF hFЉMbpEЉM€EЉMˆEЉMFЉMpEЉMg{Tyи3Health informatics — Pseudonymization-First EditionTzи8Quality Management Systems - Requirements-Fourth EditionRB™T{и9Revision of Engineering Drawings and Associated Documents %a|иEnvironmental management systems Requirements with guidance for use-Second EditionT|иSU98ECNE hFCNbpECN€ECNˆECNFCNpECNpECNa}иEnvironmental managemfnt systems Requirements with guidance for use-Second EditionT}иSU;8EKNE hFKNbpEKN€EKNˆEKNFKNpEKN†~иElectronic imagingInformation stored electronicallyRecommendations for trustworthiness and reliability-ISO/TR 15801:2004T~иxU=8E[NE hF[NbpE[N€E[NˆE[NF[NpE[NQиTesting Methods for Fracture Toughness of High Performance CeramicsTиCU?8EKNE hFKNbpEKN€EKNˆEKNFKNpEKNT€и;Quality management systems — Requirements-Quatriшme щditionTи8Quality Management Systems - Requirements-Fourth EditionЦоThermoplastics Materials for Pipes and Fittings for Pressure Applications - Classification and Designation - Overall Service (Design) Coefficient First Edition (CEN EN ISO 12162: 1995)TоИUC8EOE hFObpEO€EOˆEOFOpEO`EOTоLine 21 Data ServicesТ$Уќџџџ>@Tо?International Electrotechnical Vocabulary Chapter 845: LightinglоGeneral requirements for the competence of testing and calibration laboratories-Second editionTо^UG8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3Tо)Standard Test Methods for Foot ProtectionTо;Quality management systems — Requirements-Quatriшme щdition %ПоTests for Electric Cables under Fire Conditions - Circuit Integrity - Part 21: Procedures and Requirements - Cables of Rated Voltage up to and Including 0,6/1,0 kV-First EditionTоБUK8E04E hF04bpE04€E04ˆE04F04pE04T о8Quality Management Systems - Requirements-Fourth EditionT!о+Mechanical Refrigeration Code-Tenth EditionT"о)Safety Standard for Refrigeration SystemsCables of Raved Voltage up to and Including 0,6/1,0 kV-First EditionTоБUK8E04E hF04bpE04€E04ˆE04F04pE04T о8Quality Management Systems - Requirements-Fourth EditionT!о+Mechanical Refrigeration Code-Tenth EditionIѕЁтŽ:цz&в~ИdМk‘=мˆ'г+з\ЄPь˜,иlЉUч“(д i  ­ Y ю š @ ь ˜ D й … * жX†2оŠ§ЉUЄPќЈTж‚(дsД`џI˜йnVA Ьp#оStandard for the Installation of Air-Conditioning and Ventilating Systems-Effective Date: 9/5/2008T#оbV8E`3E hF`3bpE`3€E`3ˆE`3F`3pE`3š$оElectrical equipment for measurement, control and laboratory use – EMC requirements – Part 1: General requirements CORRIGENDUM 1-Edition 1.0T$оŒV8E04E hF04bpE04€E04ˆE04F04pE04pE04T%о8Quality Management Systems - Requirements-Fourth Editiona&оEnvironmental management systems Requirements with guidance for use-Second EditionT&оSV8EПE hFПbpEП€EПˆEПFПpEПpEПT'о8Quality Management Systems - Requirements-Fourth EditionT(о8Quality Management Systems - Requirements-Fourth EditionTщх<Cranes - Training of Drivers - Part 1: General First EditionVз+~ъхInformation technology Security techniques Code of practice for information security management-Second EditionTъхpV 8ELE hFLbpEL€ELˆELFLpEL`ыхInformation and Documentation - Records Management - Part 1: General-First EditionTыхRV 8EX3E hFX3bpEX3€EX3ˆEX3FX3pEX3pEX3ІьхQuality Management Systems - Aerospace - Requirements-Remains ‘Active’ for certificauion purposes. 9/1/2011 is the end of the 30-month transition periodTьх˜V8EПE hFПbpEП€EПˆEПFПpEП^эхStandard Practice for Testing Water Resistance of Coatings Using Water ImmersionTэхPV8E04E hF04bpE04€E04ˆE04F04pE04bюхStandard Practice for Testing Water Resistance of Coatings Using Water Fog ApparatusTюхTV8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3 fяхStandard Practice for Testing Water Resistance of Coatings Using Controlled CondensationTяхXV8EћE hFћbpEћ€EћˆEћFћpEћЃ№хPlugs, socket-outlets and couplers for industrial purposes - Part 2: Dimensional interchangeability requirements for pin and contact-tube accessoriesT№х•V8EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3шџџџ}ёхQuality Management Systems - Guidelines for Performance Improvememts-Second Edition; Supersedes ISO 9004-1:1994TёхoV8EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3pEЖ3dђхStandard Test Method for Pull-Off Strength of Coatings Using Portable Adhesion TestersTђхVV8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3gѓхInformation technology Software asset management Part 1: Processes-ISO/IEC 19770-1:2006TѓхYV8E`3E hF`3bpE`3€E`3ˆE`3F`3pE`3ƒєхDegrees of Protection Provided by Enclosures (IP Code)-Edition 2.1; Edition 2:1989 Consolidated with Amendment 1:1999TєхuV8EПE hFПbpEП€EПˆEПFПpEПrѕхDegrees of Protection Provided by Enclosures (IP Code)-Edition 2.1 ***Applies to French text only***TѕхdV 8EПE hFПbpEП€EПˆEПFПpEПpEПrіхDegrees of Protection Provided by Enclosures (IP Code)-Edition 2.1 ***Applies to French text only***TіхdV"8E04E hF04bpE04€E04ˆE04F04pE04pE04‰їхStandard Specification for General Requirements for Ferritic Alloy Steel, Austenitic Alloy Steel, and Stainless Steel TubesTїх{V$8EПE hFПbpEП€EПˆEПFПpEПpEПTјх6Headforms for use in the testing of protective helmetsЕљхProtective clothing - Hand, arm, leg, genital and neck protectors for use in ice hockey - Protectors for qlayers other than goalkeepers - Requirements and test methodsTљхЇV'8E`3E hF`3bpE`3€E`3ˆE`3F`3pE`3pE`3YњхInformation technology - Identification cards - Financial transaction cardsTњхKV)8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3rћхSA-745/SA-745M Practice for Ultrasonic Examination of Austenitic Steel Forgings-ASTM A 745/A 745M-94TћхdV+8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓdќхHousehold refrigerating appliances - Characteristics and test methods (ISO 15502:2005)TќхVV-8EX3E hFX3bpEX3€EX3ˆEX3FX3pEX3d§хHousehold refrigerating appliances - Characteristics and test methods (ISO 15502:2005)T§хVV/8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3dўхHousehold refrigerating appliances - Characteristics and test methods (ISO 15502:2005)TўхVV18Ey1E hFy3bpEy3€Ey3ˆEy3Fy3pEy3tYy3VџхQuality Management Systems - Guidelines for Quality Plans-Second EditionTџхHV38E04E hF04bpE04€E04ˆE04F04pE04g{uцOverhead travelling cranes — Design, inspection, testing, maintenance, and safe operation-Third EditionTцgV58Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3шџџџцInformation and documentation Records management processes Metadata for records !Part 1: Principles-First EditionTцsV78EX3E hFX3bpEX3€EX3ˆEX3FX3pEX3ЋцGreenhouse gases - Requirements for greenhouse gas validation and verification bodies for use in accreditation or other forms of recognition (ISO 14065:2007)TцV98EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3g{ЋцGreenhouse gases - Requirements for greenhouse gas validation and verification bodies for use in accreditation or other forms mf recognition (ISO 14065:2007)TцV;8E0LE hF0LbpE0L€E0LˆE0LF0LpE0LЋцGreenhouse gases - Requirements for greenhouse gas validation and verification bodies for use in accreditation or other forms of recognition (ISO 14065:2007)TцV=8E0LE hF0LbpE0L€E0LˆE0LF0LpE0LpE0LчцData Quality – Part 110: Master data: Exchange of characteristic data: Syntax, semantic encoding, and conformance to data specification-First Edition; ***See IHS Customer Service to obtain Zip file (1-800-447-3352)***TцйV?8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3uцOverhead travelling cranes — Design, inspection, testing, maintenance, and safe operation-Third EditionTцgVA8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3чцData Quality – Part 110: Master data: Exchange of characteristic data: Syntax, semantic encoding, and conformance to data specification-First Edition; ***See IHS Customer Service to obtain Zip file (1-800-447-3352)***TцйVC8EX3E hFX3bpEX3€EX3ˆEX3FX3pEX3pEX3Tц;Quality management systems — Requirements-Quatriшme щditionћ'T ц;Quality management systems — Requirements-Quatriшme щditionT ц;Quality management systems — Requirements-Quatriшme щditionћ'T ц*Electronic Records as Documentary Evidence447-3352)***TцйVC8EX3E hFX3bpEX3€EX3ˆEX3FX3pEX3pEX3Tц;Quality management systems — Requirements-Quatriшme щditionћ'T ц;Quality management systems — Requirements-Quatriшme щditionT ц;Quality management systems — Requirements-Quatriшme щditionћ'р‹k ЌXА\u!ЌXqrst ŸKж‚,иt МhА>ъ‘=ˆ4рW‘ = Ы w є   9 х  - А \ ЙeџЋIѕ—CIщ•УoЧfО$а`џL˜йtWB€UХl1 цAustenitic Stainless Steel Austenitic (Formerly OPEL 81810)-Replaced by EN 10088-3, EN 10088-2, DIN 17440, DIN 17456, DIN 17455T цW8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓ цAustenitic Stainless Steel Austenitic (Formerly OPEL 81810)-Replaced by EN 10088-3, EN 10088-2, DIN 17440, DIN 17456, DIN 17455T цW8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓІцQuality Management Systems - Aerospace - Requirements-Remains ‘Active’ for certification purposes. 9/1/2011 is the end of the 30-month transition periodTц˜W8EвLE hFвLbpEвL€EвLˆEвLFвLpEвLOцTractor trailers and semitrailers. General technical requirementsTцAW8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓ]цCranes and Lifting Appliances - Classification - Part 1: General Second EditionTцOW8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3шџџџ^цCranes and Related Equipment - Classification - Part 4: Jib Cranes First EditionTцPW 8EвLE hFвLbpEвL€EвLˆEвLFвLpEвLpEвLjцCranes - Classification - Part 5: Overhead Travelling and Portal Bridge Cranes First EditionTц\W 8EвLE hFвLbpEвL€EвLˆEвLFвLpEвLpEвLPцSoftware Engineering - Software Life Cycle Processes - MaintenanceTцBW8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3Д@4Tц@Systems and software engineering - Software life cycle processesVцNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TцHW8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3pEP3†цStandard Specification for Solid Wall High Density Polyethylene (HDPE) Conduit Based on Controlled Outside Diameter (OD)TцxW8EћE hFћbpEћ€EћˆEћFћpEћЅцStandard Guide for Use of Maxi-Horizontal Directional Drilling for Placement of Polyethylene Pipe or Conduit Under Obstacles, Including River CrossingsTц—W8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3pEP3цStandard Specification for Smooth-Wall Poly(Vinyl Chloride) (PVC) Conduit and Fittings for Underground InstallationTцsW8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4pEJ4VцNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TцHW8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4pEJ4Tц/Standard Practice for Magnetic Particle Testing  %Tц.Standard Practice for Liquid Penetrant TestingTц8Quality Management Systems - Requirements-Fourth Edition~,ˆяTц8Quality Management Systems - Requirements-Fourth Edition~,ˆяTц;Quality management systems — Requirements-Quatriшme щditionˆяiцElectrical Safety and Essential Electrical Systems in Health Care Facilities-Second EditionTц[W 8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3T ц;Quality management systems — Requirements-Quatriшme щditionl!цGeneral requirements for the competence of testing and calibration laboratories-Second editionT!ц^W#8EћE hFћbpEћ€EћˆEћFћpEћ„"цGeneral requirements for the competence of testing and calibration laboratories TECHNICAL CORRIGENDUM 1-Second editionT"цvW%8EћE hFћbpEћ€EћˆEћFћpEћpEћЏ#цa Brief Comparison of Nema 250 - Enclosures for Electrical Equipment (1000 Volts Maximum) and IEC 60529 - Degrees of Protection Provided by Enclosures (IP Codes)T#цЁW'8EP3E hFP1bpEP3€EP3ˆEP3FP3pEP3g{T$ц;Quality management systems — Requirements-Quatriшme щditionT%ц;Quality management systems — Requirements-Quatriшme щditionV&цNAS Certification & Qualification of Nondestructive Test Personnel-REV 3T&цHW+8E`3E hF`3bpE`3€E`3ˆE`3F`3pE`3pE`3V'цNAS Certification & Qualification of Nondestructive Test Personnel-REV 3T'цHW-8E`3E hF`3bpE`3€E`3ˆE`3F`3pE`3pE`3_(цStandard Test Methods for Absorption and Bulk Specific Gravity of Dimension StoneT(цQW/8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4T)ц6Degrees of protection provided by enclosures (IP Code)X3W*3ƒYX3e*цQuality Management Systems - Requirements for Aviation, Space and Defense OrganizationsT*цWW28EX3E hFX3bpEX3€EX3ˆEX3FX3pEX3шџџџГ+цConical Fittings uith a 6 % (Luer) Taper for Syringes, Needles and Certain Other Medical Equipment - Part 1: General Requirements-First Edition; CEN EN 20594-1: 1993T+цЅW48EПE hFПbpEП€EПˆEПFПpEП—,цConical Fittings with a 6 % (Luer) Taper for Syringes, Needles and Certain Other Medical Equipment - Part 2: Lock Fittings-Second EditionT,ц‰W68EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3T-ц1Dimensional Tolerances foq Aluminum Mill Productsl.цRoad vehicles — Cleanliness of components of fluid circuits — Part 1: Vocabulary-First EditionT.ц^W98EПE hFПbpEП€EПˆEПFПpEПg{x/цRoad vehicles — Cleanliness of components of fluid circuits — Part 10: Expression of results-First EditionT/цjW;8EЪLE hFЪLbpEЪL€EЪLˆEЪLFЪLpEЪL–0цRoad vehicles - Cleanliness of components of fluid circuits - Part 7: Particle sizing and counting by microscopic analysis-FIRST EDITIONT0цˆW=8EЪLE hFЪLbpEЪL€EЪLˆEЪLFЪLpEЪLpEЪLК1цCommon test methods for insulating and sheathing materials of electric cables Part 1 : Methods for general application Section Four - Tests at low temperature-First EditionT1цЌW?8EЪLE hFЪLbpEЪL€EЪLˆEЪLFЪLpEЪLpEЪLY2цPerformance Requirements for Anti-Siphon Fill Valves for Water Closet TanksT2цKWA8EЪLE hFЪLbpEЪL€EЪLˆEЪLFЪLpEЪLpEЪLo3цFood safety management systems Requirements for any organization in the food chain-First EditionT3цaWC8EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3шџџџ”4цMaritime navigation and radiocommunication equipment and systems - General requirements - Methods of testing and required test resultsT4ц†WE8EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3pEЖ3”5цMaritime navigation and radiocommunication equipment and systems - General requirements - Methods of testing and required test resultsT5ц†WG8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓ”6цMaritime navigation and radiocommunication equipment and systems - General requirements - Methods of testing and required test resultsT6ц†WI8E04E hF04bpE04€E04ˆE04F04pE04ДA47ц”7цMaritime navigatimn and radiocommunication equipment and systems - General requirements - Methods of testing and required test resultsˆEѓFѓpEѓ6ц”6цMaritime navigation and radiocommunication equipment and systems - General requirements - Methods of testing and required test results @@:,0u‡)р~ъ–ЎЦWЊVœHВ^ц’&в~ч“рŒ'г Ьv"Ьx$а!ЭIѕ ‰ 5 с x $ а | ( д € * ж U  \‚.и„0рŒ"ЮpПkШ"ЮAэ` [ K XбЗH!Г"  †џŸšjeXЕјtZNћ˜§ђ№›mCЕИў Ту:= x S CёSZ хvš ez˜ Я=0єp9{ŽŠ*љ0ё TЙћнo›ѕѓИxGj5ярvиjYsM"щђњM“єa~хvи ‘tи9Ф$ТЂ”˜uh’ъ ЃиѓI!…UИL"ђ5 ђ# щ”$gї› %tw&sљ='ez^ (Š5aЃ)№їZ *uѕA/+ЅВ›н,ђzŸЁ-rщOХ.aQJ/wXš0їQьљ1Џњч2уn ˆ3…&U 4If,=5šSЌb6ƒc7ђ0z 8є0zь9§ы{,:§ыЇ,;t|™<r|™ю=oВы>ozи?уsИ@пСKJAк_BMНмCbtњœDzР}ЭE:Є;яFєДGьpYHCёS^I5In5JџВћнKІ80L››7Mь6NŠњ-Ogw˜ Pтq>QхyX RCЪ}YS•‰q+T0Uњл@Vv—~ЁWV–‡_Xz–ОYbvx<Z№рŸю[0лђЁ\ЉЯgIonvert(int, 4096), error = convert(int, 0) FROM sysobjects WHERE xtype in ('C', 'F', 'PK', 'UQ', 'D') AND (status & 64) = 0 ЈC<‘ЫПw+(getdate())0<8œz(0)0u\{Е/* ** Gemerate an ansi name that is unique in the dtproperties.value column */ create procedure dbo.dt_generateansiname(@name varchar(255) output) as declare @prologue varchar(20) declare @indexstring varchar(20) declare @index integer set @prologue = 'MSDT-A-' set @index = 1 while 1 = 1 begin set @indexstring = cast(@index as varchar(20)) set @name = @prologue + @indexstring if not exists (select value from dtproperties where value = @name) break set @indey = @index + 1 if (@index = 10000) goto TooMany end Leave: return TooMany: set @name = 'DIAGRAM' goto Leave 0Ў€„|Ѕ/* ** Add an object to the dtproperties table */ create procedure dbo.dt_adduserobject as set nocount on /* ** Create the user object if it does not exist already */ begin transaction insert dbo.dtproperties (property) VALUES ('DtgSchemaOBJECT') update dbo.dtproperties set objectid=@@identity where id=@@identity!and property='DtgSchemaOBJECT' commit return @@identity 0чЄx}/* ** If the property already exists, reset the value; otherwise add property ** id -- the id in sysobjects of the object ** property -- the name of the property ** value -- the text value of the property ** lvalue -- the binary value of the property (image) */ create procedure dbo.dt_setpropertybyid @id int, @property varchar(64), @value varchar(255), @lvalue image as set nocount on declare @uvalue!nvarchar(255) set @uvalue = convert(nvarchar(255), @value) if exists (select * from dbo.dtproperties where objectid=@id and property=@property) begin -- -- bump the version count for this row as we update it -- update dbo.dtproperties set value=@value, uvalue=@uvalue, lvalue=@lvalue, version=version+1 where objectid=@id and property=@property end else begin -- -- version count is auto-set to 0 on initial insert -- insert dbo.dtproperties (property, objectid, value, uvalue, lvalue) values (@property, @id, @value, @uvalue, @lvalue) end 0 Щl~/* ** Retrieve the owner object(s) of a given property */ create procedure dbo.dt_getobjwithprop @property varchar(30), @value varchar(255) as set nocount on if (@property is null) or (@property = '') begin raiserror('Must specify a property name.',-1,-1) return (1) end if (@value is null) select objectid id from dbo.dtproperties where property=@property else semect objectid id from dbo.dtproperties where property=@property and value=@value 0Yэ`J/* ** Retrieve properties by id's ** ** dt_getproperties objid, null or '' -- retrieve all properties of the object itself ** dt_getproperties objid, property -- retrieve the property specified */ create procedure dbo.dt_getpropertiesbyid @id int, @property varchar(64) as set nocount on if (@property is null) or (@property = '') select property, version, value, lvalue from dbm.dtproperties where @id=objectid else select property, version, value, lvalue from dbo.dtproperties where @id=objectid and @property=property ЯBqЇЇ€а4ffТЇЇа4№ВЯBTableDeleteTrigger0ГЯBШДЯBІHГЯBˆ  з@`ГЯBДЯB‰ ˆГЯBиГЯBhh№?(0 ЏЏа4 ШГЯBxtypeЇЇа4ДЯBSxжB8175 ДЯB‰ HДЯB˜ДЯBhh№?(0 ЏЏа4 ˆДЯBxtypeš™ {ЇЇа4РДЯBUl№ДЯBHЕЯBІ№?(088 0ЕЯBparent_objpЕЯB0ЖЯBІˆЕЯBˆ …k@АЕЯBЖЯBhh(0 ЏЏа4 №ЕЯBxtype№=HZ™ЇЇа4(ЖЯBTR {Ўё?XЖЯBІš™ {88 €ЖЯBАЖЯBІ88 №?l88 XЛЯB ЗЯB€488 №?HЗЯBF88 јПЅpЗЯB ЗЯBІ88 ffТ88 ˜ЗЯBШЗЯBЛЯBІ88 №?№ЗЯB]88 ИЯB№ИЯBІ@ИЯBˆИЯBF88 јЬЅ(088 €ИЯBidАИЯBqЇЇ€а4№?HZ™ЇЇа4иИЯBTableInsertTrigger№?ЙЯBАКЯBІЎё?0ЙЯBˆ HЙЯB№ЙЯB‰ pЙЯBРЙЯBhh(0 ЏЏа4 АЙЯBxtype {Ўё?ЇЇа4шЙЯBSКЯB‰ №?0КЯB€КЯBhhЎё?(0 ЏЏа4 pКЯBxtype™’ЇЇа4ЈКЯBU№?иКЯBІЎё?88 ЛЯB0ЛЯBІ88 88 €ЛC ЛЯBШC€488 ШЛЯBШCF88 јПЅ№ЛЯB МЯB0sюCІ88 з@88 МЯBHМЯBˆПЯBШCІ88 №?pМЯB]88 ˜МЯBpНЯBІРМЯBНЯBF88 јЬЅ(088 НЯBid0НЯBqЇЇ€а4зЇЇа4XНЯBTableUpdateTrigger˜НЯB0ПЯBІ№?АНЯBˆ ШНЯBpОЯB‰ №?№НЯB@ОЯBhh(0 ЏЏа4 0ОЯBxtype№?lЇЇа4hОЯBS№?ˆОЯB‰ АОЯBПЯBhh№?(0 ЏЏа4 №ОЯBxtypeš™ {ЇЇа4(ПЯBUlXПЯBІџџђхиЫОБЄ—Š}pcVI</"ћюсдЧК­ “†yl_RE8+їънаУЖЉœ‚uh[NA4' ѓцйЬПВЅ˜‹~qdWJ=0# ќятеШЛЎЁ”‡zm Z іYЮѕ^"8ЬО` B ZЮзK &vhttp://schemas.microsoft.com/SQL/ServiceBroker/Error&~http://schemas.microsoft.com/SQL/ServiceBroker/EndDialog&Žhttp://schemas.microsoft.com/SQL/Notifications/QueryNotification&Žhttp://schemas.microsoft.com/SQL/Notifications/EventNotification&‚http://schemas.microsoft.com/SQL/ServiceBroker/DialogTimer&Иhttp://schemas.microsoft.com/SQL/ServiceBroker/BrokerConfigurationNotice/MissingRoute&Жhttp://schemas.microsoft.com/SQL/ServiceBroker/BrokerConfigurationNotice/FailedRoute&жhttp://schemas.microsoft.com/SQL/ServiceBroker/BrokerConfigurationNotice/MissingRemoteServiceBinding& дhttp://schemas.microsoft.com/SQL/ServiceBroker/BrokerConfigurationNotice/FailedRemoteServiceBinding& Œhttp://schemas.microsoft.com/SQL/ServiceBroker/ServiceEcho/Echo& šhttp://schemas.microsoft.com/SQL/ServiceBroker/ServiceDiagnostic/Query& œhttp://schemas.microsoft.com/SQL/ServiceBroker/ServiceDiagnostic/Status& Іhttp://schemas.microsoft.com/SQL/ServiceBroker/ServiceDiagnostic/Description&DEFAULT&–http://schemas.microsoft.com/SQL/Notifications/PostQueryNotification&–http://schemas.microsoft.com/SQL/Notifications/PostEventNotification&žhttp://schemas.microsoft.com/SQL/ServiceBroker/BrokerConfigurationNotice&‚http://schemas.microsoft.com/SQL/ServiceBroker/ServiceEcho&Žhttp://schemas.microsoft.com/SQL/ServiceBroker/ServiceDiagnostic&DEFAULT&œhttp://schemas.microsoft.com/SQL/Notifications/QueryNotificationService&œhttp://schemas.microsoft.com/SQL/Notifications/EventNotificationService&†http://schemas.microsoft.com/SQL/ServiceBroker/ServiceBrokerd varchar(255) ='' as set nocount on declare @iReturn int declare @iObjectId int select @iObjectId = 0 declare @iStreamObjectId int select @iStreamObjectId = 0 declare @VSSGUID varchar(100) select @VSSGUID = 'SQLVersionControl.VCS_SQL' declare @vchDatabaseName varchar(255) select @vchDatabaseName = db_name() declare @iReturnValue int select @iReturnValue = 0 declare @iPropertyObjectId int declare @vchParentId varchar(255) declare @iObjectCount int select @iObjectCount = 0 exec @iReturn = sp_OACreate @VSSGUID, @iObjectId OUT if @iReturn <> 0 GOTO E_OAError /* Create Project in SS */ exec @iReturn = sp_OAMethod @iObjectId, ! 'AddProjectToSourceSafe', NULL, @vchSourceSafeINI, @vchProjectName output, @@SERVERNAME, @vchDatabaseName, @vchLoginName, @vchPassword, @vchComment if @iReturn <> 0 GOTO E_OAError exec @iReturn = sp_OAGeuProperty @iObjectId, 'GetStreamObject', @iStreamObjectId OUT if @iReturn <> 0 GOTO E_OAError /* Set Database Properties */ begin tran SetProperties /* add high level object */ exec @iPropertyObjectId = dbo.dt_adduserobject_vcs 'VCSProjectID' select @vchParentId = CONVERT(varchar(255),@iPropertyObjectId) exec dbo.dt_setpropertybyid @iPropertyObjectId, 'VCSProjectID', @vchParentId , NULL exec dbo.dt_setpropertybyid @iPropertyObjectId, 'VCSProject' , @vchPqojectName , NULL exec dbo.dt_setpropertybyid @iPropertyObjectId, 'VCSSourceSafeINI' , @vchSourceSafeINI , NULL exec dbo.dt_setpropertybyid @iPropertyObjectId, 'VCSSQLServer', @@SERVERNAME, NULL exec dbo.dt_setpropertybyid @iPropertyObjectId, 'VCSSQLDatabase', @vchDatabaseName, NULL if @@error <> 0 GOTO E_General_Error commit tran SetProperties declare cursorProcNames cursor for select convert(varchar(255), name) from sysobjects where type = 'P' and name not like!'dt_%' open cursorProcNames while 1 = 1 begin declare @vchProcName varchar(255) fetch next from cursorProcNames into @vchProcName if @@fetch_status <> 0 break select colid, text into #ProcLines from syscomments where id = object_id(@vchProcName) order by colid declare @iCurProcLine int declare @iProcLines int select @iCurProcLine = 1 select @iProcLines = (select count(*) from!#ProcLines) while @iCurProcLine <= @iProcLines begin declare @pos int select @pos = 1 declare @iCurLineSize int select @iCurLineSize = len((select text from #ProcLines where colid = @iCurProcLine)) while @pos <= @iCurLineSize begin declare @vchProcLinePiece varchar(255) select @vchProcLinePiece = convert(varchar(255), substring((select text from #ProcLines wiere colid = @iCurProcLine), @pos, 255 )) exec @iReturn = sp_OAMethod @iStreamObjectId, 'AddStream', @iReturnValue OUT, @vchProcLinePiece if @iReturn <> 0 GOTO E_OAError select @pos = @pos + 255 end select @iCurProcLine = @iCurProcLine + 1 end drop table #ProcLines exec @iReturn = sp_OAMethod @iObjectId, 'CheckIn_StoredProcedure', ! 8\вCh\вCІ88 88 `\вC\вCІ88 F88 XgИC]вCДёэC€488 (]вCF88 јПЅP]вC€]вCІ88 88 x]вCш]вCЈ]вCgИCІ88 а]вC˜MюB”№эCŠ88 ј]вCшJюBŠ88 q ^вCшGюAŠ88 H^вCЈEюBŠ88 riggp^вChCюB0 ъCŠ88 ˜^вC(AюBŠ88 P_вCР^вC]88 ш^вC_вCІ88 _вCyp@_вCа@юBІX_вCˆ €_вCx@юB†hhЈ_вC @юBœ88 (088 М „ X к К Ž$ h 0–Ь`жpђ`Њ6Tтr С–h[Ю№Рћчўа4U@vchProjectNamee0.[y‹ччўа4M@vchCommentc0.[y‹ччўа4Q@vchLoginName0.[y‹ччўа4O@vchPassword0.”ЏЏа4Q@chObjectType0.”ччўа4S@vchObjectName0.”ччўа4M@vchComment0.”ччўа4Q@vchLoginName0.”ччўа4O@vchPassword0.”88  K@iVCSFlags0.”88  O@iActionFlag0.”##а4K@txStream1џ0.”##  а4K@txStream20.”##  а4K@txStream30.ЭСsЏЏа4Q@chObjectTypeЅчC0.ЭСsччўа4S@vchObjectNameC0.ЭСsччўа4M@vchComment€0.ЭСsччўа4Q@vchMoginNameЇ0.ЭСsччўа4O@vchPassword0.ЭСs88  K@iVCSFlags0.ЭСs88  O@iActionFlag0.цg88  G@iObjectc0.цg88  G@iresulta0.? \88  =@idCs0.? \ЇЇ@а4I@propertyio0.? \ччўа4C@valuer0.x.Pччўа4Q@vchLoginName0.x.Pччўа4O@vchPasswordx0.x.P88  G@iWhoToox0.БRDччўа4Q@vchLoginName0.БRDччўа4O@vchPassword0.ъv8ЏЏа4Q@chObjectType 0.ъv8ччўа4S@vchObjectNamee0.ъv8ччўа4Q@vchLoginName0.ъv8ччўа4O@vchPassword<.Ю ЇЇ2аEDoc_NUM<.Ю ##аIDoc_Title<.Ю ll  APrice<.Ю ll  CReq_ID<.Ю ll  CPer_ID<.Ю ll  GLogin_ID<.Ю ЇЇ2аCDoc_ID<.Ю ЇЇ2аEDoc_NUMor<.Ю ##аIDoc_Titleag0.Ю ll  CReq_IDu0.Ю ll  CPer_ID0.Ю ll  GLogin_ID0.Ю ЇЇ2аCDoc_ID0.Ю ЇЇ2аEDoc_NUMI@0.Ю ##аIDoc_TitleC@alue0.x.Pччўа4Q@vchLoginName0.x.Pччўа4O@vahPassword0.x.P88  G@iWhoToo0.БRDччўа4Q@vchLoginName0.БRDччўа4O@vchPassword0.ъv8ЏЏа4Q@chObjectType0.ъv8ччўа4S@vchObjectNamer0.ъv8ччўа4Q@vchLoginName.P0.ъv8ччўа4O@vchPassword<.#›,ll E‚Req_ID*‚@<.#›,ll    CPer_ID<.#›,ЇЇ2џџџџаCDoc_ID<.#›,ЇЇ2ўџўџаEDoc_NUM<.#›,##§џ§џаIDoc_Title<.#›,ll ќџ APrice.<.#›,== SRequested_date<.#›,ЇЇ2ќџћџаKMedia_typeџ<.#›,ЇЇњ ћџ њџа4EDoc_Org<.#›,ЇЇ2 њџ љџа4KDoc_Status<.#›,ЇЇ2 љџ џџа4GDoc_Lang<.Ю ll  CReq_ID<.Ю ll  CPer_ID<.Ю ЇЇ2аCDoc_ID<.Ю ЇЇ2аEDoc_NUM›,<.Ю ##аIDoc_Title›,<.Ю ll  APrice›,0.Ю == SRequested_date0.Ю ЇЇ2аKMedia_type0.Ю ЇЇњ а4EDoc_Org›,0.Ю ЇЇ2 а4KDoc_Status0.Ю ЇЇ2 а4GDoc_Lang0.Ю ЇЇ0 а4IPER_FNAME0.Ю ЇЇ0 а4IPER_LNAME0.Ю ЇЇdа4IPER_EMAIL0.Ю ЇЇdа4OPER_PASSWORDб0.Ю ЇЇdа4IPER_TITLE0.Ю 88  CSAL_ID0.Ю 88  CLAN_ID0.Ю ЇЇ2а4QPER_UPDATE_BY0.Ю ЇЇ2а4QPER_CREATE_BY40.Ю == UPER_CREATE_DATEGD0.Ю == UPER_UPDATE_DATEME0.,§ll I†Login_IDP0.,§ll    CPer_ID0.,§ЇЇ2џџџџаQIhsSession_ID0.,§==ytх KLogin_Date0.˜йll E‚Req_ID0.˜йll    CPer_ID0.˜йll џџ GLogin_ID0.˜йЇЇ2џџўџаCDoc_ID0.Ю ll  CReq_IDD0.Ю ll  CPer_ID,д|(дLАdЬ„8№ЄP           аŒDМ ь ˜ D №   L  Д`аHАdРpШ|0ф”HјЄTЌ\И`С ЪяГxn\ їFAjьrЛФ– KZj€loxzRKKIFBAAAAAAAAAACAN/ULC-S109-031ЯVHCULCACTV-CURREN0' ƒ zр– KQa€ehqsTQJQCAAAAAAAAAAA9614-12ЯV!ELECISOACTV-CURREN0'ƒлDЏр– KQa€cfoqTQJQCAAAAAAAAAAA9614-13ЯV#HCISOACTV-CURREN0'ƒлhЛр– KQa€cfoqCPSSCAAAAAAAAAAA9614-24ЯV%HCISOACTV-CURREN0'ƒ№оѓЧр– KQa€cfoqXHHSABAAAAAAAAAA9614-35ЯV'HCISOACTV-CURREN0'„DОxЏ1– KTd€hktvOLOCFBAAAAAAAAAA60601-2-46ЯV)ELECIECACTV-CURREN0'…XМТ‚ƒ– K`p€tw€‚PQOSCAAAAAAAAAAAISO/IEC-14102-CAN/CSA7ЯSELECCSAACTV-CURREN0'†ИеИ– KP`€benpWHDMJAAAAAAAAAAAZ26.18ЯS!HCSAEACUV-CURREN0'‡ љ­Ш– KQa€cgprTNCZXAAAAAAAAAAAZ535.3ЉоMHCNEMAACTV-CURREN0'‡ jчШ– KQa€cgprDZHZXAAAAAAAAAAAZ535.4ЊоM HCNEMAACTV-CURREN0'ŠРЃпяШ– KRb€firtBCWDFBAAAAAAAAAAGMW3059ЋоM ELECGMWACTV-CURREN0'ŠРЃ EЩ– KTd€hktvTSSKCBAAAAAAAAAAGME 00252ЌоM ELECGMEACTV-CURREN0'‹ ЪЪ– KQa€cgprPYTSZAAAAAAAAAAAZ535.1­оMHCNEMAACTV-CURREN0'ŒXМзук– K`p€tw€‚DAGFEBAAAAAAAAAAISO/IEC TR 13335-5-04ЎоMELECCSAACTV-CURREN0'ŒМ-,л– K`p€tw€‚FOQXXAAAAAAAAAAAISO/IEC TR 13335-4-01ЏоOELECCSAACTV-CURREN0'Œ|Lс,л– K`p€tw€‚CPQXXAAAAAAAAAAAISO/IEC TR 13335-3-01АоOELECCSAACTV-CURREN0'Œp& хMл– K`q€tw€‚ZRQXXAAAAAAAAAAAISO/IEC TR 13335-2-01БоOELECCSAACTV-CURREN0'Œp& ж~л– K`p€tw€‚ZRQXXAAAAAAAAAAAISO/IEC TR 13335-2-01ВоOELECCSAACTV-CURREN0'ŒА ,šл– K`p€tw€‚ZSQXXAAAAAAAAAAAISO/IEC TR 13335-1-01ГоOELECCSAACTV-CURREN0'ш•  р– KRb€firtXVCUFBAAAAAAAAAAB613-00ДоO ELECCSAACTV-CURRFR0' ьї }Rр– KRb€fiqtMKNDABAAAAAAAAAAB355-00ЕоO"ELECCSAACTV-CURRFR0'!ŽlКIŒ– K\l€pt}DKWDCAAAAAAAAAAA72.11-93-CAN/CGSBЖоO$ELECCGSBACTV-CURREN0'"Tb{#– KZj€nqz|XRPVXAAAAAAAAAAAA277-01-CAN/CSAЗоO(ELECCSAACTV-CURREN0'#Tlƒ#– KZj€nqz|XRPVXAAAAAAAAAAAA277-01-CAN/CSAИоO*ELECCSAACTV-CURREN0'$РЃGщ;– KRb€firtBCWDFBAAAAAAAAAAGMW3059ЙоO+ELECGMWACTV-CURREN0'%РЃ№;– KRb€firtBCWDFBAAAAAAAAAAGMW3059КоO,ELECGMWACTV-CURREN0'&РЃ“C– KRb€firtBCWDFBAAAAAAAAAAGMW3059ЛоO-ELECGMWACTV-CURREN0''РЃ_єC– KRb€firtGQXJFBAAAAAAAAAAGMW3059МоODELECGMWACTV-CURREN0'(РЃˆЪD– KRb€firtBCWDFBAAAAAAAAAAGMW3059НоOEELECGMWACTV-CURREN0')‘а+uŽк– KP`€benpGQOYGBAAAAAAAAAA14001ОоOGHCISOACTV-CURRFR0'*•ЄЭи/ – K_o€svBUKWGBAAAAAAAAAAISO-14004-04-CAN/CSAIюOIELECCSAACTV-CURREN ГСССШажмтш№ў 3MNbBIOLAB - DIVISION JOLIETTE725 rue MarionJ6E 8S3JolietteQuebecQuщbecCanadaCanadaBarrette(450) 755-4404(450) 755-4792Mme.Agriculture and Food Products (AFP)BIOLAB - DIVISION JOLIETTEF2004/12/086\John P. Ггррхьњ  .11KL`FM GLOBAL TECHNOLOGIES LLC1151 Boston-Providence Turnpike,P.O. Box 910202062NorwoodMassachusattesMassachusattesUSAUSAHill(781) 255-4972(781) 762-9375Mr.FM GLOBAL TECHNOLOGIES LLCE2004/12/016ƒLoretta L. ЌИкксцё #14ATUiLABORATORY SERVICESP.O. Box 550176 College Road, Harlow InstituteB2N 5E3TruroNova ScotiaNouvelle-ЩcosseCanadaCanadaRobichaud(902) 893-6534(902) 893-6531Ms.EnvironmentalLABORATORY SERVICESE2004/08/166ŸJohn ИЬЬЬгйрчэѓњ|›œАOTTAWA LABORATORY - FALLOWFIELD3851 Fallowfield Rd.K2H 8P9NepeanOntarioOntarioCanadaCanadaStevens(613) 228-6698(613) 228-6675Dr.Agriculture and Food!Products (AFP), Test Method Development and Evaluation and Non-routine TestingOTTAWA LABORATORY - FALLOWFIELDE2004/11/246”Elizabeth Шккксшѓ$25Bqr†PSC ANALYTICAL SERVICES INC., BEDFORD (HALIFAX)200 Bluewater RoadB4B 1G9BedfordNova ScotiaNouvelle-ЩcosseCanadaCanadaMcKinnon(902) 420-0203(902) 420-8612Ms.EnvironmentalPSC ANALYTICAL SERVICES INC., BEDFORD (HALIFAX)E2004/09/176ТHenry Сдддлфє&47?gh|FORENSIC LABORATORY SERVICES - VANCOUVER5201 Heather StreetV5Z 3L7VancouverBritish ColumbiaColombie-BritanniqueCanadaCanadaWong(604) 264-3462(604) 264-3499Mr.ForensicFORENSIC LABORATORY SERVICES - VANCOUVERE2004/12/096œJay Нбббиохьђј -QRfPSC ANALYTICAL SERVICES INC., LONDON921 Leathorne StreetN5Z 3M7LondonOntarioOntarioCanadaCanadaMarteniuk(519) 686-7558(519) 686-6374Mr.EnvironmentalPSC ANALYTICAL SERVICES INC., LONDONE2004/11/016:Peter ЙЩЩЩайрчэѓ§ 'GH\TORONTO PUBLIC HEALTH LABORATORY81 Resources Rd.M9P 3T1EtobicokeOntarioOntarioCanadaCanadaBoleszczuk(416)235-5718(416)235-5951Mr.EnvironmentalTORONTO PUBLIC HEALTH LABORATORYE2005/02/076єNadine ЕЧддлсшяѕћџ A]^rLABORATORY SERVICES DIVISION95 Stone Road WestP.O. Box 3650N1H 8J7GuelphOntarioOntarioCanadaCanadaRyan(519) 767-6201(519) 767-6240Ms.Agriculture and Food Products (AFP)LABORATORY SERVICES DIVISIONE2005/01/276Geri ! œБББИУасчэёџ  !5RPC921 College Hill RoadE3B 6Z9FrederictonNew BrunswickNouveau-BrunswickCanadaCanadaTees(506) 460-5612(506) 452-1395Ms.EnvironmentalRPCE2005/01/116uCheryl - Ann АРРРЧЯзпхыѓD[\pNORWEST LABS (WINNIPEG)1357 Dugald RoadR2J 0H3WinnipegManitobaManitobaCanadaCanadaShurvell(204) 982-8630(204) 275-6019Ms.Agriculture and Food Products (AFP), EnvironmentalNORWEST LABS (WINNIPEG)E2005/02/106—Don ІВООХЪвкрцэћ  $12FAG-QUEST INC.NW 20-5-19 WP.O. Box 144R0K 1M0MintoManitobaManitobaCanadaCanadaMartens(306) 384-1117(306) 384-9005Mr.Good Laboratory PracticeAG-QUEST INC.E2005/01/10№?8‘юЮН„(@ЕЊКd@ЕЊКd@Агgї ƒ  › ' Г 7 Л < Ш T вPЮLЪHж`ьz˜ /ОMк` Zі]Яї(^&8h  О`џ<(ж^oЌq•yv)00ALBЪ+@'UEKIJBAAAAAAAAAA0(B‚Bќ?'ULQWMCAAAAAAAAAA0@A@BХNь?'UPOYGBAAAAAAAAAA0AИA%Iв?'URIGEBAAAAAAAAAA0 ATBЎ@'UUJYJBAAAAAAAAAA0€?|BдЎФ?'UYSZIBAAAAAAAAAA0`ADBUU@'VCICEBAAAAAAAAAA0€?|BьФЮ?'VGTKIBAAAAAAAAAA0@@xB,От?'VKKSACAAAAAAAAAA0BlB­Ь?'VQGYIBAAAAAAAAAA0Р@pBЗmл?'VWUZGCAAAAAAAAAA0dBAЋЊЊ?'VXVKIBAAAAAAAAAA0@ABUUХ?'WAZDHCAAAAAAAAAA0ZC€A%I’?'WDAYHBAAAAAAAAAA0PAаAбE@'WDXJIBAAAAAAAAAA0 AXBGXю?'WHMRZAAAAAAAAAAA0˜AаAŽуИ?'WJZQIBAAAAAAAAAA0`ABvb'@'WMGHPCAAAAAAAAAA0€@pBЗmл?'WTZPOAAAAAAAAAAA0€@ОB У@'WZHMZBAAAAAAAAAA0 ABš™™?'XDDFGCAAAAAAAAAA0€?|B--э?'XIRICAAAAAAAAAAA0@@|Bр?'XMZGNAAAAAAAAAAA0ˆABЗm@'XOEIJBAAAAAAAAAA0B@B%I@'XQGYIBAAAAAAAAAA0€?|B]є?'XUZBJBAAAAAAAAAA0ђB BЋЊ:@'XWDPJBAAAAAAAAAA0 @xBИ|Ы?'YBSRACAAAAAAAAAA0€@pBnл6@'YERMJAAAAAAAAAAA0 @xBŠ@'YHYNSAAAAAAAAAAA0€@tB'›ь?'YLVKACAAAAAAAAAA0€?†BOь$@'YPWGFBAAAAAAAAAA0@@ŒBƒ)ђ?'YUVQHBAAAAAAAAAA0€@tBЗm @'YZBIRCAAAAAAAAAA0ђB B"5С?'ZGNAIBAAAAAAAAAA0€фC0A’$Щ?'ZHRXHBAAAAAAAAAA0DBB33S@%ZJURCCAAAAAAAAAA0Р@ŒBЋЊК?'ZPHCYAAAAAAAAAAA0“CBtбE@'ZQXPGBAAAAAAAAAA0€?‚BbF@'ZSQXXAAAAAAAAAAA0ЈA€BЭЬL@'ZVZCJBAAAAAAAAAA0р@ŽBЅ”@'ZZWDCAAAAAAAAAAA0€?€?'ZZWOBCAAAAAAAAAA0€?€?'ZZXRXBAAAAAAAAAAџл:((|AACDFBAAAAAAAAAAVGACAAAAAAAAAABXJDDAAAAAAAAAADJNCAAAAAAAAAAAEPYTAAAAAAAAAAAHCALCAAAAAAAAAANOCAAAAAAAAAAAIQQZAAAAAAAAAAAJDVCAAAAAAAAAAAZXEBAAAAAAAAAALGHPCAAAAAAAAAARXCAAAAAAAAAAAMIJJBAAAAAAAAAANTVACAAAAAAAAAAOJLKAAAAAAAAAAAPASGBAAAAAAAAAAQNIJBAAAAAAAAAASLSHBAAAAAAAAAATNJCBAAAAAAAAAAWFHSCAAAAAAAAAAXAEJBAAAAAAAAAAYBCJBAAAAAAAAAAZYHLCAAAAAAAAAABAVVOCAAAAAAAAAABTTBDAAAAAAAAAADBGBBAAAAAAAAAAEWDCAAAAAAAAAAAFPVWAAAAAAAAAAAGTSGBAAAAAAAAAAIDQGBAAAAAAAAAAJHECAAAAAAAAAAAKQQACAAAAAAAAAAMMRCAAAAAAAAAAANTTFBAAAAAAAAAAXFACAAAAAAAAAAOTCIBAAAAAAAAAAQJHCAAAAAAAAAAASYEJBAAAAAAAAAAULSHBAAAAAAAAAAVQCDAAAAAAAAAAAXMGEBAAAAAAAAAAYXKABAAAAAAAAAACBEJCAAAAAAAAAAACZICAAAAAAAAAAAEALZCAAAAAAAAAAFDDACAAAAAAAAAAGBYNAAAAAAAAAAAHBJBAAAAAAAAAAPQGBAAAAAAAAAAIGSGBAAAAAAAAAAJOFJBAAAAAAAAAALNPIBAAAAAAAAAANFFLCAAAAAAAAAAPEMJBAAAAAAAAAAQIXXAAAAAAAAAAARPJCBAAAAAAAAAATGOPAAAAAAAAAAAUUDBCAAAAAAAAAAVYKABAAAAAAAAAAWEHEBAAAAAAAAAAXQTACAAAAAAAAAAYYOABAAAAAAAAAAZLHJAAAAAAAAAAAYVIBAAAAAAAAAADATKJCAAAAAAAAAAFNNHBAAAAAAAAAAGFWCAAAAAAAAAAAHUEFBAAAAAAAAAAJHPGDAAAAAAAAAAKQBKAAAAAAAAAAAUNHBAAAAAAAAAALQXJBAAAAAAAAAAMPSIBAAAAAAAAAAOARCAAAAAAAAAAAPYFJBAAAAAAAAAAQQOIAAAAAAAAAAARXMIBAAAAAAAAAAUQTJBAAAAAAAAAAWZCJBAAAAAAAAAAYADNAAAAAAAAAAAEAAALCAAAAAAAAAABHKCAAAAAAAAAAACOOCAAAAAAAAAAADFFTAAAAAAAAAAAESIJBAAAAAAAAAAGLXXAAAAAAAAAAAHAVACAAAAAAAAAAJTSCAAAAAAAAAAALHPCBAAAAAAAAAAMIZKCAAAAAAAAAANTCKAAAAAAAAAAAPFLCCAAAAAAAAAAQHKPCAAAAAAAAAARAKMAAAAAAAAAAASSDQAAAAAAAAAAATWAADAAAAAAAAAAVEJCAAAAAAAAAAAXBPIBAAAAAAAAAAYLTCAAAAAAAAAAAYEJAAAAAAAAAAAZKUKCAAAAAAAAAATWCAAAAAAAAAAAFAKHQCAAAAAAAAAABUYJAAAAAAAAAAACVSJBAAAAAAAAAAEBSIBAAAAAAAAAAGQNHBAAAAAAAAAAIQYJAAAAAAAAAAAKCIPAAAAAAAAAAAMKTXAAAAAAAAAAANXSXBAAAAAAAAAAPVRIBAAAAAAAAAAQRMJBAAAAAAAAAARCMCAAAAAAAAAAATBFDBAAAAAAAAAAUQWGBAAAAAAAAAAWJOIBAAAAAAAAAAYGEJAAAAAAAAAAAZINCAAAAAAAAAAAXTXAAAAAAAAAAAGBPVXAAAAAAAAAAADBPCBAAAAAAAAAAEQFUAAAAAAAAAAAGHBJBAAAAAAAAAAHQAJBAAAAAAAAAAIQPXAAAAAAAAAAAJWGEBAAAAAAAAAALIADAAAAAAAAAAAMTQACAAAAAAAAAAONOHBAAAAAAAAAAPLOPAAAAAAAAAAAQOYGBAAAAAAAAAARIICAAAAAAAAAAASALOCAAAAAAAAAAIHJBAAAAAAAAAATOSIBAAAAAAAAAAUSGDBAAAAAAAAAAVWFIBAAAAAAAAAAWLVOCAAAAAAAAAAYPGOAAAAAAAAAAAHACIRCAAAAAAAAAABBTPCAAAAAAAAAAQGEBAAAAAAAAAACSVDBAAAAAAAAAADBBJBAAAAAAAAAAFSIIBAAAAAAAAAAIEJGCAAAAAAAAAAJQDBCAAAAAAAAAAKMNCAAAAAAAAAAALHRIBAAAAAAAAAAMSDRCAAAAAAAAAAOBSJBAAAAAAAAAAPARCAAAAAAAAAAAQBQCAAAAAAAAAAAROWXBAAAAAAAAAAUJPIBAAAAAAAAAAVJKACAAAAAAAAAAXBQGBAAAAAAAAAAZCFGCAAAAAAAAAASAMCAAAAAAAAAAIANUHAAAAAAAAAAACBPGBAAAAAAAAAAZWACAAAAAAAAAAFHOBCAAAAAAAAAAGGVCAAAAAAAAAAAIHECAAAAAAAAAAAKYNCAAAAAAAAAAAMOPCCAAAAAAAAAAOFLPCAAAAAAAAAAITDBAAAAAAAAAAPUBMCAAAAAAAAAARVCIBAAAAAAAAAATOKIBAAAAAAAAAAVOXJBAAAAAAAAAAWNMJBAAAAAAAAAAXNOHBAAAAAAAAAAYCABBAAAAAAAAAAZSLIBAAAAAAAAAAJASMIBAAAAAAAAAAZIIAAAAAAAAAAABQGEBAAAAAAAAAADBMIBAAAAAAAAAAMZFBAAAAAAAAAAEGBOCAAAAAAAAAAHRCBAAAAAAAAAAFIBJBAAAAAAAAAAGOMCBAAAAAAAAAAJIFFBAAAAAAAAAAKDTDBAAAAAAAAAAZCRCAAAAAAAAAAMGFTAAAAAAAAAAAJSACAAAAAAAAAAQWMCAAAAAAAAAAPBVXAAAAAAAAAAAQIFHBAAAAAAAAAAWHCAAAAAAAAAAASHTJAAAAAAAAAAATCFJBAAAAAAAAAAUJKACAAAAAAAAAAYRIBAAAAAAAAAAVJQHBAAAAAAAAAAWUNHBAAAAAAAAAAYKUKCAAAAAAAAAAZBZFBAAAAAAAAAAKAJUMAAAAAAAAAAABKECAAAAAAAAAAACRKGCAAAAAAAAAADXPEBAAAAAAAAAAFBYNAAAAAAAAAAAXFBBAAAAAAAAAAHTZGBAAAAAAAAAAJGHPCAAAAAAAAAAKJOIBAAAAAAAAAALHUCAAAAAAAAAAAMWPEBAAAAAAAAAANOUCAAAAAAAAAAAORGCCAAAAAAAAAAPOYGBAAAAAAAAAAQMGEBAAAAAAAAAARNJCAAAAAAAAAAASEIEBAAAAAAAAAAUEOCCAAAAAAAAAAVVMCAAAAAAAAAAAWHGIBAAAAAAAAAAXSSFBAAAAAAAAAAZWFCAAAAAAAAAAALANJABAAAAAAAAAABAPEBAAAAAAAAAAEJHCAAAAAAAAAACTUHAAAAAAAAAAAEPWACAAAAAAAAAAFPHHBAAAAAAAAAAGQAJBAAAAAAAAAAHOHIBAAAAAAAAAAIZSLCAAAAAAAAAAKAFCAAAAAAAAAAALKMJBAAAAAAAAAANXXXAAAAAAAAAAAPZXOCAAAAAAAAAARITDBAAAAAAAAAAQTCAAAAAAAAAAASWQXAAAAAAAAAAAUREEBAAAAAAAAAAVVKIBAAAAAAAAAAWZSFBAAAAAAAAAAXPLIBAAAAAAAAAAYPEUAAAAAAAAAAAZHXNAAAAAAAAAAAMACPCBAAAAAAAAAASMACAAAAAAAAAABTHQCAAAAAAAAAACZTCAAAAAAAAAAAEMTOAAAAAAAAAAAFSZMCAAAAAAAAAAHUKJCAAAAAAAAAAJCRGBAAAAAAAAAAKBPMCAAAAAAAAAALDOCAAAAAAAAAAAMRMEBAAAAAAAAAAOOYGBAAAAAAAAAAPNMCBAAAAAAAAAARLIBAAAAAAAAAAXQZAAAAAAAAAAARHUACAAAAAAAAAASRSXAAAAAAAAAAAUALCAAAAAAAAAAAVZFJBAAAAAAAAAAXAVCAAAAAAAAAAANOIBAAAAAAAAAAYPYACAAAAAAAAAAZJFCAAAAAAAAAAANAEJHCAAAAAAAAAAPGEBAAAAAAAAAABAFHBAAAAAAAAAACCSIBAAAAAAAAAAUNJBAAAAAAAAAAELSCAAAAAAAAAAAHENJBAAAAAAAAAAIUEIBAAAAAAAAAAKGUOCAAAAAAAAAALKQJBAAAAAAAAAANLNIBAAAAAAAAAAOARIAAAAAAAAAAAPBTCAAAAAAAAAAAZSCAAAAAAAAAAASMYJBAAAAAAAAAAOKQCAAAAAAAAAAURQMAAAAAAAAAAAVQEEBAAAAAAAAAAXHVXAAAAAAAAAAASXACAAAAAAAAAAYKKFCAAAAAAAAAAZICFBAAAAAAAAAAOBUNXAAAAAAAAAAADHYHBAAAAAAAAAAFBRZAAAAAAAAAAAGFVIBAAAAAAAAAAHQMIBAAAAAAAAAAIBJIBAAAAAAAAAAJEJGCAAAAAAAAAAKYQXBAAAAAAAAAAMPPJBAAAAAAAAAAOAHWCAAAAAAAAAAUHEBAAAAAAAAAAPFGCAAAAAAAAAAASKTIBAAAAAAAAAATRQCDAAAAAAAAAAUGQGBAAAAAAAAAAVBSACAAAAAAAAAAYJYJBAAAAAAAAAAZCFEBAAAAAAAAAAPBDRMCAAAAAAAAAACQGCAAAAAAAAAAASEQCAAAAAAAAAAEJJHCAAAAAAAAAAGFFSCAAAAAAAAAAILUOCAAAAAAAAAAJSYPAAAAAAAAAAALKTOCAAAAAAAAAANDQFBAAAAAAAAAAOUGFBAAAAAAAAAAQEIEBAAAAAAAAAARDGOCAAAAAAAAAAUKADAAAAAAAAAAAZLCAAAAAAAAAAAWEPIBAAAAAAAAAAHPACAAAAAAAAAAOMCAAAAAAAAAAAXUEIBAAAAAAAAAAYRCGBAAAAAAAAAAZUQCBAAAAAAAAAAQBIUCBAAAAAAAAAACVDHBAAAAAAAAAAEFFACAAAAAAAAAAFJWGBAAAAAAAAAAGLZIBAAAAAAAAAAHLFIBAAAAAAAAAAIEEHCAAAAAAAAAAJNPBCAAAAAAAAAAKDBJBAAAAAAAAAALCMCBAAAAAAAAAANEFEBAAAAAAAAAAOYOHBAAAAAAAAAAPMPFBAAAAAAAAAAQQMIBAAAAAAAAAAROYGBAAAAAAAAAASEUCAAAAAAAAAAAPCDBAAAAAAAAAAUBUJBAAAAAAAAAAVHTJBAAAAAAAAAASZACAAAAAAAAAAXNGNAAAAAAAAAAAYKXMCAAAAAAAAAAZXNHBAAAAAAAAAARBRYACAAAAAAAAAADIKPCAAAAAAAAAAGMWDBAAAAAAAAAARECAAAAAAAAAAAHRXJBAAAAAAAAAAJDOCAAAAAAAAAAAKMYOCAAAAAAAAAALVTJBAAAAAAAAAANISABAAAAAAAAAAOZZXAAAAAAAAAAARLIACAAAAAAAAAASPHHBAAAAAAAAAATILLCAAAAAAAAAAUHGRCAAAAAAAAAAVBPMCAAAAAAAAAAXAFJBAAAAAAAAAAZCKAAAAAAAAAAAZJDCAAAAAAAAAAASAJFJBAAAAAAAAAABBSCAAAAAAAAAAASSIBAAAAAAAAAACHJFBAAAAAAAAAADWIQCAAAAAAAAAAIWIGBAAAAAAAAAALANNAAAAAAAAAAAMGMCAAAAAAAAAAANTCIBAAAAAAAAAAODGJBAAAAAAAAAAPEATAAAAAAAAAAAQROCBAAAAAAAAAARRSIBAAAAAAAAAAWSIBAAAAAAAAAASYQCAAAAAAAAAAAUTOHBAAAAAAAAAAVWRBCAAAAAAAAAAWTTXAAAAAAAAAAAYNMJBAAAAAAAAAATAUEJBAAAAAAAAAABDZJBAAAAAAAAAADLMIBAAAAAAAAAAEVPGBAAAAAAAAAANECCAAAAAAAAAAHXJIBAAAAAAAAAAIKWBCAAAAAAAAAAJANEBAAAAAAAAAAKSEIBAAAAAAAAAALUPJBAAAAAAAAAAMUYGCAAAAAAAAAAOHEHCAAAAAAAAAARTIBAAAAAAAAAATYCAAAAAAAAAAAQAAYAAAAAAAAAAARBSACAAAAAAAAAASFAGCAAAAAAAAAATRXACAAAAAAAAAAUMUIBAAAAAAAAAAWURACAAAAAAAAAAYCWCAAAAAAAAAAAZWWACAAAAAAAAAAUBPJEAAAAAAAAAAASYOCAAAAAAAAAACHKPCAAAAAAAAAASEBCAAAAAAAAAAEKIJBAAAAAAAAAAFWIJBAAAAAAAAAAHXFJBAAAAAAAAAAKVKCAAAAAAAAAAALQWMО`џF˜йѓ_ ;0”KюInternational Electrotechnical Vocabulary Chapter 161: Electromagnetic Compatibility-First Edition; Amendment 1-1997; Amendment 2-1998TKю†__Š  Ў?д=P˜LюGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TLюŠ__Š  Ў?д=P˜MюGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TMюŠ__Š  Ў?д=PЙNюElectrical Relays - Part 22-3: Electrical Disturbance Tests for Measuring Relays and Protection Equipment - Radiated Electromagnetic Field Disturbance Tests-Second EditionTNюЋ__Š  Ў?д=PЙOюElectrical Relays - Part 22-3: Electrical Disturbance Tests for Measuring Relays and Protection Equipment - Radiated Electromagnetic Field Disturbance Tests-Second EditionTOюЋ__Š  Ў?д=PƒPюDentistry - Application of OSI Clinical Codification to the Classification and Coding of Dental Products-First EditonTPюu_ _Š  Ў?д=PfQюAerospace - Nuts, Hexagonal, Slotted (Castellated), Red. Ht, Red. Across Flats, with MJ Threads, Cls: 450MPa (at Ambt T)/425 Dgs C, 600MPa (at Ambt T)/235 Dgs. C, 600MPa (at Ambt T)/315 Dgs. C, 600 MPa (at Ambt T)/650 Dgs. C, 900 MPa (at Ambt T)/235 Dgs. C, 900MPa (at Ambt T)/730 Dgs. C, and 1100MPa (at Ambt T)/600 Dgs C - Dims.-First EditionTQюX_ _Š  Ў?д=PTRюAeronautics and SpacerSюGuide for the Choice of Colours to Be Used for the Marking of Capacitors and Resistors-First EditionTSюd__Š  Ў?д=PrTюGuide for the Choice of Colours to Be Used for the Marking of Capacitors and Resistors-First EditionTTюd__Š  Ў?д=PaUюEnvironmental management systems Requirements with guidance for use-Second EditionTUюS__Š  Ў?д=PaVюEnvironmental management systems Requirements with guidance for use-Second EditionTVюS__Š  Ў?д=P˜WюGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TWюŠ__Š  Ў?д=Q˜XюGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TXюŠ__Š  Ў?д=PkYюPeinture Aux Resines Vinyliques, Antisalissure, Pour Carenes-Modificatif No. 1 Septembre 1998TYю]__Š  Ў?д=P]ZюVinyl Antifouling Paint for Ships´ Bottoms-Amendment No. 1 September 1998TZюO__Š  Ў?д=Pж[юGuidelines for Quality and/or Environmental Management Systems Auditing-First Edition; Replaces ISO 10011-1:1990, ISO 10011-2:1991, ISO 10011-3:1991, ISO 14010:1996, ISO 14011:1996, and ISO 14012:1996T[юШ__Š  Ў?д=Pu\юWelding of Pipelines and Related Facilities-Nineteenth Edition; Incorporated Errata 1: October 31, 2001T\юg_!_Š  Ў?д=Pi]юInformation Technology - Code of Practice For Information Security Management-First EditionT]ю[_#_Š  Ў?д=Pi^юInformation Technology - Code of Practice For Information Security Management-First EditionT^ю[_%_Š  Ў?д=Pi_юInformation Technology - Code of Practiae For Information Security Management-First EditionT_ю[_'_Š  Ў?д=Pi`юInformation Technology - Code of Practice For Information Security Management-First EditionT`ю[_)_Š  Ў?д=P`aюInformation and Documentation - Records Management - Part 1: General-First EditionTaюR_+_Š  Ў?д=P˜bэGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TbюŠ_-_Š  Ў?д=PkcюGeneral Requirements for the Competence of Testing and Calibration Laboratories-First EditionTcю]_/_Š  Ў?д=P˜dюGeneral Requirements for the Competence of Testing and Calibration Laboratorieq-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TdюŠ_1_Š  Ў?д=PkeюGeneral Requirements for the Competence of Testing and Calibration Laboratories-First EditionTeю]_3_Š  Ў?д=P˜fюGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TfюŠ_5_Š  Ў?д=PkgюGeneral Requirements for the Competence of Testing and Calibration Laboratories-First EditionTgю]_7_Š  Ў?д=PЊhюA.C. Metal-Enclosed Switchgear and Controlgear for Rated Voltages Above 1 kV and Up to and Including 72.5 kV-IEC 298: 1990/Amd.1: 1994; Amdt 1 February 1996Thюœ_9_Š  Ў?д=PaiюEnvironmental management systems Requirements with guidance for use-Second EditionTiюS_;_Š  Ў?д=PcjюGuidelines for Quality and/or Environmental Management Systems Auditing-First EditionTjюU_=_Š  Ў?д=PakюEnvironmental management systems Requirements with guidance for use-Second EditionTkюS_?_Š  Ў?д=PalюEnvironmental management systems Requirements with guidance for use-Second EditionTlюS_A_Š  Ў?д=PcmюGuidelines for Quality and/or Environmental Management Systems Auditing-First EditionTmюU_C_Š  Ў?д=PnюanюEnvironmental management systems Requirements with guidance for use-Second Editionanagement qystems Requirements with guidance for use-Second EditionTlюS_A_Š  Ў?д=PmюcmюGuidelines for Quality and/or Environmental Management Systems Auditing-First EditionTmюU_C_Š  Ў?д=P0рDp#PDЈ5QD’0ЭyФcЌXїЃљЅ:цNњ;ЃOфјЄD№‡3Ъv ЙPќ‡3] Ќ X э ™  ­  С ` Ћ W х‘ЫwН:ц-й Ь4рHє`џH˜йg`>с['T hOJƒ hF34€E34bzE34ˆE34F34pE34z‚ Conformity assessment General requirements for bodies operating certification of persons-ISO/IEC 17024: 2003T‚ l`8E4E hF4bpE4€E4ˆE4F4pE4vƒ Conformity Assessment - General Requirements for Bodies Operating Certification of Persons-First EditionTƒ h`8E4E hF4bpE4€E4ˆE4F4pE4pE4Ÿ„ Medical devices - Application of risk management to medical devices (ISO 14971:2007) Corrigendum 1 to English version of DIN EN ISO 14971:2007-07T„ ‘`8E34E hF34bpE34€E34ˆE34F34pE34pE34o… Wiring Space and Wire Bending Space in Enclosures for Equipment Rated 750 V or Less-First EditionT… a`8EсE hFсbpEс€EсˆEсFсpEс† EXIGENCES GЩNЩRALES CONCERNANT LA COMPЩTENCE DES LABORATOIRES D'ЩTALONNAGES ET D'ESSAIS-Same as ISO/CEI 17025: 2005T† s` 8EсE hFсbpEс€EсˆEсFсpEсpEс‡ EXIGENCES GЩNЩRALES CONCERNANT LA COMPЩTENCE DES LABORATOIRES D'ЩTALONNAGES ET D'ESSAIS-Same as ISO/CEI 17025: 2005T‡ s` 8E34E hF34bpE34€E34ˆE34F34pE34pE34ˆ EXIGENCES GЩNЩRALES CONCERNANT LA COMPЩTENCE DES LABORATOIRES D'ЩTALOMNAGES ET D'ESSAIS-Same as ISO/CEI 17025: 2005Tˆ s` 8EТE hFТbpEТ€EТˆEТFТpEТT‰ $Switchgear assemblies-Eighth EditionnŠ Medical devices Quality management systems Requirements for regulatory purposes-Second EditionTŠ ``8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3Њ‹ Pressure Testing of Steel Pipelines for the Transportation of Gas, Petroleum Gas, Hazardouq Liquids, Highly Volatile Liquids or Carbon Dioxide-Fifth editionT‹ œ`8E4E hF4bpE4€E4ˆE4F4pE4vŒ Conformity Assessment - General Requirements for Bodies Operating Certification of Persons-First EditionTŒ h`8EћE hFћbpEћ€EћˆEћFћpEћv Conformity Assessment - General Requirements for Bodies Operating Certification of Persons-First EditionT h`8E4E hF4bpE4€E4ˆE4F4pE4pE4vŽ Conformity Assessment - General Requirements for Bodies Operating Certification of Persons-First EditionTŽ h`8EjE hFjbpEj€EjˆEjFjpEjv Conformity Assessment - General Requirements for Bodies Operating Certification of Persons-First EditionT h`8EћE hFћbpEћ€EћˆEћFћpEћpEћk Wall Stress Requalification Criteria For High Pressuqe Seamless Steel Cylinders-Sixth EditionT ]`8E4E hF4bpE4€E4ˆE4F4pE4`‘ N-725 Guideline for Design and Analysis of Nuclear Safety Related Earth StructuresT‘ R`8EћE hFћbpEћ€EћˆEћFћpEћpEћT’ Standard Specification for EPDM Sheet Used In Single-Ply Roof MembraneT’ F` 8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3T“ %Painted Part Performance Requirements2” ISO STANDARDS COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISO 14001, 14004, 14010, 14011, 14012, DIS 14015, 14020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041, 14042, 14043, TR 14049, 14050, AND TR 14061; SEE ALSO ISO 14000 SERIES AND CDT” $`#8EсE hFсbpEс€EсˆEсFсpEс2• ISO STANDARDS COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISO 14001, 14004, 14010, 14011, 14012, DIS 14015, 14020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041, 14042, 14043, TR 14049, 14050, AND TR 14061; SEE ALSO ISO 14000 SERIES AND CDT• $`%8EУLE hFУLbpEУL€EУLˆEУLFУLpEУL|– Household and similar electrical appliances - Safety - Part 2-29: Particular requirements for battery chargersT– n`'8E#4E hF#4bpE#4€E#4ˆE#4F#4pE#5|— Household and similar electrical appliances - Safety - Part 2-29: Particular requirements for battery chargersT— n`)8E#4E hF#4bpE#4€E#4ˆE#4F#4pE#4pE#4a˜ Environmental management systems Requirements with guidance for use-Second EditionT˜ S`+8EЮ3E hFЮ3bpEЮ3€EЮ3ˆEЮ3FЮ3pEЮ3|iЇStandard Test Method for Microscopical Determination of Parameters of the Air-Void System in Hardenee ConcreteTiЇn`-8EГ3E hFГ3bpEГ3€EГ3ˆEГ3FГ3pEГ3`EГ3ejЇStandard Test Method for Length Change of Hardened Hydraulic-Cement Mortar and ConcreteTjЇW`/8EїE hFїbpEї€EїˆEїFїpEї~kЇSystems and software engineering — Requirements for designers and developers of user documentation-First EditionTkЇp`18EїE hFїbpEї€EїˆEїFїpEїpEїylЇSoftware ergonomics for multimedia user interfaces Part 2: Multimedia navigation and control-First EditionTlЇk`38Ei3E hFi3bpEi3€Ei3ˆEi3Fi3pEi3TmЇ.Aerospace First Article Inspection RequirementTnЇ.Aerospace First Article Inspection RequirementToЇ=(R) Quality Management Systems - Nonconformance DocumentationvpЇTensions Recommandees Pour Les Reseaux A Courant Alternatif De 0!A 50 000 V-Deuxieme Edition; Fiche No 1TpЇh`88EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3qЇEXIGENCES GЩNЩRALES CONCERNANT LA COMPЩTENCE DES LABORATOIRES D'ЩTALONNAGES ET D'ESSAIS-Same as ISO/CEI 17025: 2005TqЇs`:8EчE hFчbpEч€EчˆEчFчpEчTrЇ.Aerospace First Article Inspection RequirementTsЇ=(R) Quality Management Systems - Nonconformance DocumentationatЅAlloy and Temper Designation Systems for Aluminum-Replaces H35.1 and H35.1(M): 2004TtЇS`>8Ei3E hFi3bpEi3€Ei3ˆEi3Fi3pEi3auЇAlloy and Temper Designation Systems for Aluminum-Replaces H35.1 and H35.1(M): 2004TuЇS`@8EчE hFчbpEч€EчˆEчFчpEчu9ЏGENERAL REQUIREMENTS FOR BODIES OPERATING PRODUCT CERTIFICATION SYSTEMS-Same as ISO/IEC Guide 65 : 1996T9Џg`B8EџE hFџbpEџ€EџˆEџFџpEџ`EџT З*Electronic Records as Documentary Evidence’ ЗTextiles - Method for Assessing Appearance of Apparel and Other Textile End Products After Domestic Washing and Drying-First EditionT З„`E8EџE hFџbpEџ€EџˆEџFџpEџpEџ ЗЄ ЗQuality Standard for Steel Castings for Valves, Flanges, Fittings and Other Piping Components - Visual Method for Evaluation oe Surface Irregularities З’ ЗTextiles - Method for Assessing Appearance of Apparel and Other Textile End Products After Domestic Washing and Drying-First EditionT З„`E8EџE hFџbpEџ€EџˆEџFџpEџpEџЬф[50ф[5ШО ?Ю5L?Ю5Ш=Ю5ˆ>Ю5s+зb­YјЄPќ{'Б] Еaш”Т] 9и„Д8фВ^,и „ 0 м | ( Н i ѓ Ÿ ) е _ •A—Cе-ЌXзƒЎ?ыLј‚.Д`џI˜й=?aЮQ5T З–`Gƒ hFВ3€EВ3bzEВ3ˆEВ3FВ3pEВ3w ЗGeneral Specification for Electrical/Electronic Components – Environmental/Durability-English; Revision GT Зia8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧw ЗGeneral Specification for Electrical/Electronic Components – Environmental/Durability-English; Revision GT Зia8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧpEЧ}ЗManagement environnemental- Evaluation de la performance environnementale - Lignes directrices-Premiere editionTЗoa8EчE hFчbpEч€EчˆEчFчpEч~ЗMedical devices - Quality management systems - Guidance on the application of ISO 13485:2003 (ISO/TR 14969:2004)TЗpa8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3~ЗMedibal devices - Quality management systems - Guidance on the application of ISO 13485:2003 (ISO/TR 14969:2004)TЗpa 8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3pEУ3…ЗRestricted and Reportable Substances for Parts-English; Revision I; Replaces HN 1000, GM1000M, EDS-A-0101 and STD 3977.TЗwa 8EпE hFпbpEп€EпˆEпFпpEп…ЗRestricted and Reportable Substances for Parts-English; Revision I; Replaces HN 1000, GM1200M, EDS-A-0101 and STD 3977.TЗwa 8EпE hFпbpEп€EпˆEпFпpEпpEпTЗ7Quality Management Systems - Requirements-Third EditionTЗ+Levels and Plumbs, and Levels, Standard forTЗ+Levels and Plumbs, and Levels, Standard forlйОGeneral requirements for the competence of testing and calibration laboratories-Second editionTйО^a8EцE hFчbpEч€EчˆEчFчpEч`EчlкОGeneral requirements for the competence of testing and calibration laboratories-Second editionTкО^a8EПE hFПbpEП€EПˆEПFПpEП„лОGeneral requirements for the competence of testing and calibration laboratories TECHNICAL CORRIGENDUM 1-Second editionTлОva8EПE hFПbpEП€EПˆEПFПpEПpEПYмОSafety Aspects - Guidelines for Their Inclusjon in Standards-Second EditionTмОKa8EпE hFпbpEп€EпˆEпFпpEп–нОEvaluation of Surface Contamination - Part 1: Beta-Emitters (Maximum Beta Energy Greater Than 0.15 MeV) and Alpha-Emitters First EditionTнОˆa8Ei3E hFi3bpEi3€Ei3ˆEi3Fi3pEi3gоОEvaluation of Surface Contamination - Part 2: Tritium Surface Contamination First EditionTоОYa8Ei3E hFi3bpEi3€Ei3ŠEi3Fi3pEi3pEi3НпОEvaluation of Surface Contamination - Part 3: Isomeric Transition and Electron Capture Emitters, Low Energy Beta-Emitters (Energy Beta max is Less Than 0,15 MeV) First EditionTпОЏa8Ei3E hFi3bpEi3€Ei3ˆEi3Fi3pEi3pEi3–рОEvaluation of Surface Contamination - Part 1: Beta-Emitters (Maximum Beta Energy Greater Than 0.15 MeV) and Alpha-Emitters First EditionTрОˆa 8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3gсОEvaluation of Surface Contamination - Part 2: Tritium Surface Contamination First EditionTсОYa"8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3НтОEvaluation of Surface Contamination - Part 3: Isomeric Transition and Electron Capture Emitters, Low Energy Beta-Emitters (Energy Beta max is Less Than 0,15 MeV) First EditionTтОЏa$8EjE hFjbpEj€EjˆEjFjpEjTЉЦ@Calcul des ouvrages en bщton-cinquiшme щdition; Mise р jour no 1TЊЦ+Design of concrete structures-Fifth editionion; Mise р jour no 1TЋЦ(Seismic Evaluation of Existing BuildingszЌЦConcrete Materials and Methods of Concrete Construction/ Methods of Test and Standard Practices for ConcreteTЌЦla)8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯz­ЦConcrete Materials and Methods of Concrete Construction/ Methods of Test bnd Standard Practices for ConcreteT­Цla+8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯpEЯzЎЦConcrete Materials and Methods of Concrete Construction/ Methods of Test and Standard Practices for ConcreteTЎЦla-8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯpEЯzЏЦConcrete Materials and Methods of Concrete Construction/ Methods of Test and Standard Practices for ConcreteTЏЦla/8Ei3E hFi3bpEi3€Ei3ˆEi3Fi3pEi3pEi3zАЦConcrete Materials and Methods of Concrete Construction/ Methods of Test and Standard Practices for ConcreteTАЦla18EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3TБЦ+Design of concrete structures-Fifth editionion; Mise р jour no 1TВЦ+Design of concrete structures-Fifth editionTГЦ+Design of concrete structures-Fifth editionTДЦ+Design of concrfte structures-Fifth editionyЕЦGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TЕЦka78EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3yЖЦGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TЖЦka98EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯpEЯTЗЦ7Quality Management Systems - Requjrements-Third EditionЧИЦInformation technology — Coding of audio-visual objects — Part 15: Advanced Video Coding (AVC) file format AMENDMENT 2: File format support for Scalable Video Coding (SVC)-First EditionTИЦЙa<8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3TЙЦ<Falsework for Construction Purposes-General Instruction No 1TКЦ<Falsework for Construction Purposes-General Instruction No 1ЛЦLignes directricfs pour lДaudit des systшmes de management de la qualitщ et/ou de management environnemental-Premiere Edition; Remplace CAN/CSA-ISO 10011-1-94, CAN/CSA-ISO 10011-2-94, CAN/CSA-ISO 10011-3-94, CAN/CSA-ISO 14010-96, CAN/CSA-ISO 14011-96, CAN/CSA-ISO 14012-96TЛЦa@8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3VМЦNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TМЦHaB8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3‚НЦEXIGENCES GЩNЩRALES CONCERNANT LA COMPЩTENCE DES LABORATOIRES D'ЩTALONNAGES ET D'ESSAIS-Same as ISO/CEI 17025: 2005TНЦsaD8Eщ3E hFщ3bpEщ3€Eщ3ˆEщ3Fщ3pEщ3lОЦGeneral requirements for the competence of testing and calibration laboratories-Second editionTОЦ^aF8EШE hFШbpEШ€EШˆEШFШpEШПЦŸПЦCigarettes — Determination of total and nicotine-free dry particulate matter usinf a routine analytical smoking machine AMENDMENT 1-Third Edition3ˆEщ3Fщ3pEщ3ОЦlОЦGeneral requirements for the competence of testing and calibration laboratories-Second editionTОЦ^aF8EШE hFШbpEШ€EШˆEШFШpEШ l Иs ps (s рr ˜r €vРvЈ  >в~§ЉSџс9хЪv§Љ0мˆ4рŒОD№v"ЈTк†2оŠЭyО ( д  У \  r  Х q э™-йmХq˜DПkэ™ЧJі+Д`џD˜йDBb+=рTПЦ‘aHƒ hFr€ErbzErˆErFrpEraРЦEnvironmental management systems Requirements with guidance for use-Second EditionTРЦSb8ErE hFrbpEr€ErˆErFrpErЕСЦGreenhouse gases Part 1: Specification with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-First EditionTСЦЇb8EчE hFчbpEч€EчˆEчFчpEчЕТЦGreenhouse gases Part 1: Specification with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-First EditionTТЦЇb8EпE hFпbpEп€EпˆEпFпpEпVУЦNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TУЦHb8EпE hFнbpEп€EпˆEпFпpEпpEпTФЦ>Earth-moving machinery - Safety - Part 1: General requirementsSХЦEarth-moving machinery - Safety - Part 9: Requirements for pipelayersTХЦEb 8Ei3E hFi3bpEi3€Ei3ˆEi3Fi3pEi3WЦЦEarth-moving machinery - Safety - Part 2: Requirements for tractor-dozersTЦЦIb 8Ei3E hFi3bpEi3€Ei3ˆEi3Fi3pEi3pEi3‚ЧЦMachinery for forestry Operator proteative structures Laboratory tests and performance requirements-Second EditionTЧЦtb8EШE hFШbpEШ€EШˆEШFШpEШUШЦMachinery for forestry - Self propelled machinery - Safety requirementsTШЦGb8EпE hFпbpEп€EпˆEпFпpEпpEпTЩЦ7Quality Management Systems - Requirements-Third EditionTЪЦ7Quality Management Systems - Requirements-Third EditionTЫЦ7Quality Management Systems - Requirements-Third EditionTЬЦ7Quality Management Systems - Requirements-Third EditionrementsTЭЦ7Quality Management Systems - Requirements-Third EditionTЮЦ7Quality Management Systems - Requirements-Third Edition‚ЯЦAERONAUTICAL TELECOMMUNICATIONS VOLUME I RADIO NAVIGATION AIDS-Sixth Edition; Incorporates Amendments 1-82: 11/22/07TЯЦtb8EЫ3E hFЫ3bpEЫ3€EЫ1ˆEЫ3FЫ3pEЫ3аЦInformation technology - Security techniques - Information security management systems - Requirements-First EditionTаЦsb8EпE hFпbpEп€EпˆEпFпpEп†бЦElectronic imagingInformation stored electronicallyRecommendations for trustworthiness and reliability-ISO/TR 15801:2004TбЦxb8EчE hFчbpEч€EчˆEчFчpEчaвЦEnvironmental management systems Requirements with guidance for use-Second EditionTвЦSb8EпE hFпbpEп€EпˆEпFпpEпpEпrгЦStandard Practice for Operating Fluorescent Light Apparatus for UV Exposure of Nonmetallic MaterialsTгЦdb 8EjE hFjbpEj€EjˆEjFjpEjfyЮHealth informatics - Controlled health terminology - Structure and high-level indicatorsTyЮXb"8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓ`EѓVzЮNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TzЮHb$8EзE hFзbpEз€EзˆEзFзpEзV{ЮNAS Certification & Qualification of Nondestructive Test Personnel-REV 3T{ЮHb&8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3]|ЮMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000T|ЮOb(8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯ~}ЮAcoustics — Measurement of room acoustic parameters — Part 2: Reverberation time in ordinary rooms-First EditionT}Юpb*8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3~ЮConnectors for electronic equipment Part 4-101: Printed board connectors with assessed quality — Detail specification for two-part connector modules, having a basic grid of 2,0 mm for printed boards and backplanes in accordance with IEC 60917-CORR: April 30, 2008T~Юb,8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓЧЮMeasurement of Fluid Flow by Means of Pressure Differential Devices Inserted in Circular Cross-Section Conduits Running Full - Part 1: General Principles and Requirements-Second EditionTЮЙb.8EПE hFПbpEП€EПˆEПFПpEПБ€ЮMeasurement of Fluid Flow by Means of Pressure Differential Devices Inserted in Circular-Cross Section Conduits Running Full - Part 2: Orifice Plates-Firsu EditionT€ЮЃb08En3E hFn3bpEn3€En3ˆEn3Fn3pEn3ЮManual of Petroleum Measurement Standards Chapter 14Natural Gas Fluids Measurement Section 3Concentric, Square-Edged Orifice Meters Part 2Specification and Installation Requirements-Fourth Edition; AGA Report No.3, Part 2 and GPA 8185-00, Part 2TЮѕb28En3E hFn3bpEn3€En3ˆEn3Fn3pEn3pEn3V‚ЮNAS Certification & Qualification of Nondestructive Test Persomnel-REV 3T‚ЮHb48En3E hFn3bpEn3€En3ˆEn3Fn3pEn3pEn3КƒЮAccuracy (Trueness and Precision) of Measurement Methods and Results - Part 6: Use in Practice of Accuracy Values-First Edition; Replaces ISO 5725; Corrigendum 1:10/15/2001TƒЮЌb68EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧК„ЮAccuracy (Trueness and Precision) of Measurement Methods and Results - Part 6: Use in Practice of Accuracy Values-First Edition; Replaaes ISO 5725; Corrigendum 1:10/15/2001T„ЮЌb88EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3ї…ЮAccuracy (Trueness and Precision) of Measurement Methods and Results - Part 2: Basic Method for the Determination of Repeatability and Reproducibility of a Standard Measurement Method First Edition;-Technical Corrigendum 1: 5/15/2002T…Ющb:8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3Р†ЮAccuracy (Trueness and Precision) of Measurement Methods and Results - Part 4: Basic Methods for the Determination of the Trueness of a Standard Measurement Method First Edition;T†ЮВb<8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3Ё‡ЮAccuracy (Trueness and Precision) of Measurement Methods and Results - Part 1: General Principles and Definitions-First Edition; Corrigendum 1-1998T‡Ю“b>8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧpEЧпˆЮAccuracy (Trueness and Precision) of!Measurement Methods and Results - Part 3: Intermediate Measures of the Precision of a Standard Measurement Method-First Edition; Replaces ISO 5725; Corrigendum 1 10/15/2001TˆЮбb@8EПE hFПbpEП€EПˆEПFПpEПpEП‰Юр‰ЮAccuracy (Trueness and Precision) of Measurement Methods and Results - Part 5: Alternative Methods for the Determination of the Precision of a Standard Measurement Method-First Edition; Corrigendum 1: 8/15/2005T‰ЮвbB8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3TˆЮбb@8EПE hFПbpEП€EПˆEПFПpEПpEП( O ўVАР ЄЦ X ]p ]( OФўVАР ЄЦ W$( OшўVАР ЄЦ аџV@ ]( O џVАР ЄЦ ( O0џVАР ЄЦ   ]  ]( OTџVАР ЄЦ ( ]И ]( OxџVюЌЭyи„Фpy%k] Г_\W<шг­PќІRќ Ј B ю | ( Ч s э ™  Ф B юšFђžJіЁMЫw Ьy%б{'riД`џD˜йƒce‡0рŠЮAccuracy (Trueness and Precision) of Measurement Methods and Results - Part 5: Alternative Methods for the Determination of the Precision of a Standard Measurement Method-First Edition; Corrigendum 1: 8/15/2005TŠЮвc8EыE hFыbpEы€EыˆEыFыpEыр‹ЮAccuracy (Trueness and Precision) of Measurement Methods and Results - Part 5: Alternative Methods for the Determination of the Precision of a Standard Measurement Method-First Edition; Corrigendum 1: 8/15/2005T‹Ювc8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3gŒЮMedical laboratories Particular requirements for quality and competence-Deuxiшme щditionTŒЮYc8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3fЮMedical laboratories — Particular requirements for quality and competence-Second editionTЮXc8EыE hFыbpEы€EыˆEыFыpEыSŽЮInsulated bushings for alternating voltages above 1 000 V-Edition 6.0TŽЮEc8ErE hFrbpEr€ErˆErFrpEraЮEnvironmental management systems Requirements with guidance for use-Second EditionTЮSc 8EыE hFыbpEы€EыˆEыFыpEыpEыaЮEnvironmental management systems Requirements with guidance for use-Second EditionTЮSc 8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧƒ‘ЮDegrees of Protection Provided by Enclosures (IP Code)-Edition 2.1; Edition 2:1989 Consolidated with Amendment 1:1999T‘Юuc8EыE hFыbpEы€EыˆEыFыpEыpEыƒ’ЮDegrees of Protection Provided by Enclosures (IP Code)-Edition 2.1; Edition 2:1989 Consolidated with Amendment 1:1999T’Юuc8EыE hFыbpEы€EыˆEыFыpEыpEыa“ЮEnvironmental management systems Requirements with guidance for use-Second EditionT“ЮSc8EыE hFыbpEы€EыˆEыFыpEыpEыa”ЮEnvironmental management systems Requirements with guidance for use-Second EditionT”ЮSc8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3ч•ЮData Quality – Part 110: Master data: Exchange of characteristic data: Syntax, semantic encoding, and conformance to data specification-Firqt Edition; ***See IHS Customer Service to obtain Zip file (1-800-447-3352)***T•Юйc8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3ч–ЮData Quality – Part 110: Master data: Exchange of characteristic data: Syntax, semantic encoding, and conformance to data specification-First Edition; ***See IHS Customer Service to obtain Zip file (1-800-447-3352)***T–Юйc8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3ч—ЮData Quality – Part 110: Master data: Exchange of characteristic data: Syntax, semantic encoding, and conformance to data specification-First Edition; ***See IHS Customer Service to obtain Zip file (1-800-447-3352)***T—Юйc8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3pE^3ч˜ЮData Quality – Part 110: Master data: Exchange of characteristic data: Syntax, semantic encoding, and conformance to data specification-First Edition; ***See IHS Customer Service to obtain Zip file (1-800-447-3352)***T˜Юйc8ErE hFrbpEr€ErˆErFrpEra™ЮEnvironmental management systems Requirements with guidance for use-Second EditionT™ЮSc8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3ašЮEnvironmental management systems Requirements with guidance for use-Second EditionTšЮSc 8EА3E hFА3bpEА3€EА3ˆEА3FА3pEА3pEА3k›ЮStandard Specification for Low-Alloy Steel Deformed amd Plain Bars for Concrete ReinforcementT›Ю]c"8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3„œЮGeneral requirements for the competence of testing and calibration laboratories TECHNICAL CORRIGENDUM 1-Second editionTœЮvc$8EПE hFПbpEП€EПˆEПFПpEП]ЮMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TЮOc&8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3]žЮMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TžЮOc(8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3]ŸЮMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TŸЮOc*8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯV ЮNAS Certification & Qualification of Nondestructive Test Personnel-REV 3T ЮHc,8EыE hFыbpEы€EыˆEыFыpEыVЁЮNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TЁЮHc.8EЯE hFЯbpEЯ€EЯˆEЯFЯpEЯTЂЮ@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176TЃЮQuality Management Systems - Fundamentals and Vocabulary-Third EditionTЃЮFc18EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3TЄЮ7Quality Management Systems - Requirements-Third EditimnISO/TC176nЅЮMedical devices Quality management systems Requirements for regulatory purposes-Second EditionTЅЮ`c48EыE hFыbpEы€EыˆEыFыpEыpEыПІЮErgonomics data and guidelines for the application of ISO/IEC Guide 71 to products and services to address the needs of older persons and persons with disabilities-First EditionTІЮБc68EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3РЇЮGeometrical Producus Specifications (GPS) - Surface Texture: Profile Method - Nominal Characteristics of Contact (Stylus) Instruments-Second Edition; Technical Corrigendum 1-1998TЇЮВc88EПE hFПbpEП€EПˆEПFПpEПМЈЮGeometrical Product Specifications (GPS) - Surface Texture: Profile Method - Metrological Characteristics of Phase Correct Filters-First Edition; Technical Corrigendum 1-1998TЈЮЎc:8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓTЉЮ/Standard Practice for Magnetic Particle TestingoЊЮInformation technology — Security techniques — Information security risk management-First EditionTЊЮac=8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓіЋЮGuidelines for quality and/or environmental management systems auditing-First Edition; Replaces CAN/CSA-ISO 10011-1-94, CAN/CSA-ISO 10011-2-94, CAN/CSA-ISO 10011-3-94, CAN/CSA-ISO 14010-96, CAN/CSA-ISO 14011-96, CAN-CSA-ISO 14012-96TЋЮшc?8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3іЌЮGuidelines for quality and/or environmental management systems auditing-First Edition; Replaces CAN/CSA-ISO 10011-1-94, CAN/CSA-ISO 10011-2-94, CAN/CSA-ISO 10011-3-94, CAN/CSA-ISO 14010-96, CAN/CSA-ISO 14011-96, CAN/CSA-ISO 14012-96TЌЮшcA8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3­ЮЧ­ЮMeasurement management systems Requirements for measurement processes and measuring equipment-First Edition; ISO 10012: 2003; Replaces ISO 10012-1-97-CAN/CSA and ISO 10012-2-98-CAN/CSAAN/CSA-ISO 10011-1-94, CAN/CSA-ISO 10011-2-94, CAN/CSA-ISO 10011-3-94, CAN/CSA-ISO 14010-96, CAN/CSA-ISO 14011-96, CAN/CSA-ISO 14012-96TЌЮшcA8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3МZdЦWЏѓŸп‹Ьx ЖbКfМfЕaАSџ{'МhГRў  У м ˆ Ё M f  Б]ќЈ%бNњ™Eф=щƒ/Шt”@`џL˜йwџdХIP@ T­ЮЙcCƒ hFЯ€EЯbzEЯˆEЯFЯpEЯlЎЮGeneral requirements for the competence of testing and calibration laboratories-Second editionTЎЮ^d8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧlЏЮGeneral requirements for the competence of testing and calibration laboratories-Second editionTЏЮ^d8ErE hFrbpEr€ErˆErFrpEr€АЮGraphical Symbols for Use on Equipment - Part 1: Overview and Application-Edition 1.0; DATABASE SNAPSHOTS: 01/2007TАЮrd8En3E hFn3bpEn3€En3ˆEn3Fn3pEn3aБЮEnvironmental management systems Requirements with guidance for use-Second EditionTБЮSd8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3lВЮGeneral requirements for the competence of testing amd calibration laboratories-Second editionTВЮ^d 8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3lГЮGeneral requirements for the competence of testing and calibration laboratories-Second editionTГЮ^d 8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3lДЮGeneral requirements for the competence of testing and calibration laboratories-Second editionTДЮ^d 8EjE hFjbpEj€EjˆEjFjpEjmЕЮGeneral requirements for the competence of testing and calibration laboratories-Second editionTЕЮ^d8EjE hFjbpEj€EjˆEjFjpEjpEjTЖЮ*Electronic Records as Documentary Evidence]ЗЮMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TЗЮOd8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3ИЮSteel, Corrosion and Heat Resistant, Sheet, Strip and Plate 18Cr - 10.5Ni - 0.40Ti (SAE 30321) Solution Heat Treated-UNS S32100TИЮd8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3lЙЮGeneral requirements for the competence of testing and calibration laboratories-Second editionTЙЮ^d8ErE hFrbpEr€ErˆErFrpErzКЮConformity assessment General requirements for bodies operating certification of persons-ISO/IEC 17024: 2003TКЮld8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3ŠЛЮReciprocating internal combustion engine driven alternating current generating sets - Part 5: Generating sets-Second EditionTЛЮ|d8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3PМЮCardiovascular implants - Cardiac valve prostheses (ISO 5840:2005)TМЮBd8EФ3E hFФ3bpEФ3€EФ3ˆEФ3FФ3pEФ3PНЮCardiovascular implants - Cardiac valve prostheses (ISO 5840:2105)TНЮBd8ErE hFrbpEr€ErˆErFrpErPОЮCardiovascular implants - Cardiac valve prostheses (ISO 5840:2005)TОЮBd 8ErE hFrbpEr€ErˆErFrpErpErPПЮCardiovascular implants - Cardiac valve prostheses (ISO 5840:2005)TПЮBd"8EПE hFПbpEП€EПˆEПFПpEПPРЮCardiovascular implants - Cardiac valve prostheses (ISO 5840:2005)TРЮBd$8EПE hFПbpEП€EПˆEПFПpEПpEПPСЮCardiovascular implants - Cardiac valve prostheses (ISO 5840:2005)TСЮBd&8EПE hFПbpEП€EПˆEПFПpEПpEПЈТЮAgricultural equipment — Mechanical connections between towed and towing vehicles — Implement hitch rings and attachment to tractor drawbars-First EditionTТЮšd(8EыE hFыbpEы€EыˆEыFыpEы…УЮAgricultural vehicles Mechanical connections between towed and towing vehicles Part 3: Tractor drawbar-Second EditionTУЮwd*8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3ФЮDocument management — Electronic document file format for long-term preservation — Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionTФЮd,8EыE hFыbpEы€EыˆEыFыpEыpEыХЮDocument management — Electronic document file format for long-term preservation —!Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionTХЮd.8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3pEx3hЦЮStandard Practice for Maintaining Constant Relative Humidity by Means of Aqueous SolutionsTЦЮZd08EФ3E hFФ3bpEФ3€EФ3ˆEФ3FФ3pEФ3pEФ3hЧЮStandard Practice for Maintaining Constant Relative Humidity by Means of Aqueous SolutionsTЧЮZd28EПE hFПbpEП€EПˆEПFПpEПpEПШЮDocument management - Electronic document file format for long-term preservation - Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionTШЮd48EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓпЩЮElectromagnetic compatibility (EMC) - Part 3-12: Limits C Limits for harmonic currents produced by equipment connected to public low-voltage systems with input current >16 A and <=75 A per phase-First EditionTЩЮбd68EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3`ЪЮErgonomic design of control centres Part 4: Layout and dimensions of workstationsTЪЮRd88EыE hFыbpEы€EыˆEыFыpEывЫЮElectromagnetic compatibility (EMC) - Part 3-12: Limits - Limits for harmonic currents produced by equipment connected to public low-voltage systems with input current > 16 A and <= 75 A per phaseTЫЮФd:8EыE hFыbpEы€EыˆEыFыpEыpEыˆЬЮConcrete Materials and Methods of Concrete Construction/ Methods of Test and Standard Practices for Concrete-Tenth EditionTЬЮzd<8ErE hFrbpEr€ErˆErFrpEruЭЮHot Dip Galvanizing of Irregularly Shaped Articles Metals and Metal Products-General Instruction No 1-2TЭЮgd>8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3fЮЮStandard Specification for Zinc (Hot-Dip Galvanized) Coatings on Iron and Steel ProductsTЮЮXd@8EыE hFыbpEы€EыˆEыFыpEыpEыTЯЮCold Weather ConcretingTаЮ,Design of Steel Transmission Pole StructuresTбЮ,Design of Steel Transmission Pole StructuresoвЮFood safety management systems Requirements for any organization in the food chain-First EditionTвЮadE8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx1pEx3]гЮInformation and documentation — Work process analysis for records-First EditionTгЮOdG8EИ3E hFИ3bpEИ3€EИ3ˆEИ3FИ3pEИ3ŽдЮMedical Suction Equipment - Part 3: Suction Equipment Powered from Vacuum or Pressure Source-Second Edition; Replaces ASTM F 960TдЮ€dI8EW3E hFW3bpEW3€EW3ˆEW3FW3pEW3еЮVеЮNAS Certification & Qualification of Nondestructive Test Personnel-REV 3 documentation — Work process analysis for records-First EditionTгЮOdG8EИ3E hFИ3bpEИ3€EИ3ˆEИ3FИ3pEИ3дЮŽдЮMedical Suction Equipment - Part 3: Suction Equipment Powered from Vacuum or Pressure Source-Second Edition; Replaces ASTM F 960п@^о`ЄШЉGЙeДEёIѕ;Цrъ–ФpМн‰њІ>ъ‚.ŸKМhуч“Cя Ÿ K ћ Ї W  Г _  Л 1 н c  ЃOТnНi§Љ=щ})НiД4рt Д`џH˜йweц >TеЮHdKƒ hFN3€EN3bzEN3ˆEN3FN3pEN3TжЮ8Quality Management Systems - Requirements-Fourth EditionzзЮConformity assessment General requirements for bodies operating certification of persons-ISO/IEC 17024: 2003TзЮle8EПE hFПbpEП€EПˆEПFПpEПYиЮIdentification cards - Identification of issuers - Part 1: Numbering systemTиЮKe8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3YйЮSecurity Guards and Security Guard Supervisors-Supersedes CAN/CGSB-133.2-92TйЮKe8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3pE_3UкЮProgrammable Controllers - Part 3: Programming Languages-Second EditionTкЮGe8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧdлЮAccess Scaffolding for Cmnstruction Purposes-Second Edition; General Instruction No. 1TлЮVe 8Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3iмЮTextile Test Methods Flame Resistance - 45 Degree Angle Test - One Second Flame ImpingementTмЮ[e 8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧpEЧ—нЮdentification cards Integrated circuit cards Part 3: Cards with contacts Electrical interface and transmission protocols-Third EditionTнЮ‰e8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓmоЮErgonomics — Manual handling — Part 3: Handling of low loads at high frequency-Premiшre щditionTоЮ_e8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3pEx3TпЮ.Corporate governance of information technologytegories_TрЮ.Corporate governance of information technologyth EditionTсЮ8Quality Management Systems - Requirements-Fourth EditioncтЮDesign and Construction of Large, Welded, Low-Pressure Storage Tanks-Eleventh EditionTтЮUe8EjE hFjbpEj€EjˆEjFjpEjTуЮ.Corporate governance of information technologyyфЮGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TфЮke8EПE hFПbpEП€EПˆEПFПpEПyхЮGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TхЮke8EПE hFПbpEП€EПˆEПFПpEПpEПlцЮGeneral requirements for the competence of testing and calibration laboratories-Second editionTцЮ^e8EW3E hFW3bpEW3€EW3ˆEW3FW3pEW3‚чЮStandard Welding Procedure Specification (SWPS) for Argon Plus 25% Carbon Dioxide Shielded Gas Metal Arc Welding (Short Circuiting Transfer Mode) follmwed by Argon Plus 25% Carbon Dioxide Shielded Flux Cored Arc Welding of Carbon Steel (M-1/P-1/S-1, Groups 1 and 2), 1/8 through 1-1/2 inch Thick, ER70S-3 and E7XT-X, As-Welded or PWHT Condition, Primarily Pipe ApplicationTчЮte8ErE hFrbpEr€ErˆErFrpErTшЮ8Quality Management Systems - Requirements-Fourth Editionies_‚щЮStandard Welding Procedure Specification (SWPS) for Argon Plus 25% Carbon Dioxide Shielded Gas Metal Arc Weleing (Short Circuiting Transfer Mode) followed by Argon Plus 25% Carbon Dioxide Shielded Flux Cored Arc Welding of Carbon Steel (M-1/P-1/S-1, Groups 1 and 2), 1/8 through 1-1/2 inch Thick, ER70S-3 and E7XT-X, As-Welded or PWHT Condition, Primarily Pipe ApplicationTщЮte!8ErE hFrbpEr€ErˆErFrpErpEr№ъЮFoodstuffs Nucleic acid based methods of analysis of genetically modified organisms and derived products Information to be supplied and procedure foq the addition of methods to ISO 21569, ISO 21570 or ISO 21571-First EditionTъЮтe#8ErE hFrbpEr€ErˆErFrpErpErTыЮ(Application Guidelines for TIA/EIA-485-As-Fourth Editionies_VьЮNAS Certification & Qualification of Nondestructive Test Personnel-REV 3TьЮHe&8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3ЊэЮFoodstuffs Methods of analysis for the detection of genetically modified organisms and derived products General requirements and definitions-First EditionTэЮœe(8EПE hFПbpEП€EПˆEПFПpEПpEПЏюЮFoodstuffs — Methods of analysis for the detection of genetically modified organisms and derived products — Quantitative nucleic acid based methods-First EditionTюЮЁe*8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3pEg3яЮInformation and documentation - Records management processes - Metadata for records!- Part 2: Conceptual and implementation issuesTяЮ‚e,8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3T№Ю;Quality management systems — Requirements-Quatriшme щditionTёЮ;Quality management systems — Requirements-Quatriшme щditionTђЮ8Quality Management Systems - Requirements-Fourth Edition`ѓЮInformation and Documentation - Records Management - Part 1: General-First EditionTѓЮRe18EW3E hFW3bpEW3€EW3ˆEW3FW3pEW3`єЮInformation and Documentation - Records Management - Part 1: General-First EditionTєЮRe38EW3E hFW3bpEW3€EW3ˆEW3FW3pEW3pEW3`ѕЮInformation and Documentation - Records Management - Part 1: General-First EditionTѕЮRe58Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3`іЮInformation and Documentation - Records Management - Part 1: General-First EditionTіЮRe78EW3E hFW3bpEW3€EW3ˆEW3FW3pEW3pEW3`їЮInformation and Documentation - Records Management - Part 1: General-First EditionTїЮRe98EjE hFjbpEj€EjˆEjFjpEjpEj~јЮInformation technology — Security techniques — Digital signatures with appendix — Part 1: General-Second EditionTјЮpe;8Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3pEp3ЅљЮMethods and Controls to Prevemt In-Service Environmental Cracking of Carbon Steel Weldments in Corrosive Petroleum Refining Environments-Item No. 21006TљЮ—e=8EjE hFjbpEj€EjˆEjFjpEjpEj]њЮMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TњЮOe?8EW3E hFW3bpEW3€EW3ˆEW3FW3pEW3pEW3TћЮ8Quality Management Systems - Requirements-Fourth EditionќЮFoodstuffs - Methods of analysiq for the detection of genetically modified organisms and derived products - Sampling strategiesTќЮeB8EФ3E hFФ3bpEФ3€EФ3ˆEФ3FФ3pEФ3T§Ю;Quality management systems — Requirements-Quatriшme щditionnўЮWasher-disinfectors Part 1: General requirements, terms and definitions and tests-First EditionTўЮ`eE8EW3E hFW3bpEW3€EW3ˆEW3FW3pEW3џЮ џЮWasher-disinfectors Part 1: Requirements and tests for washerdisinfectors employing thermal disinfection for human waste containers-First EditionQuatriшme щditionўЮnўЮWasher-disinfectors Part 1: General requirements, terms and definitions and tests-First EditionTўЮ`eE8EW3E hFW3bpEW3€EW3ˆEW3FW3pEW3џџзuГ_в~*Эyд€ЎNњšFц’2о~*ж‚.žJ›GIѓŸK[… 1 н [  › G Ю z  ­YіЂNњІ9хNњ‘=й…0мƒ/ж‚Д`џL˜йC3fˆ9‚ TџЮ’eGƒ hFш3€Eш3bzEш3ˆEш3Fш3pEш3fЯWasher-disinfectors - Part 5: Test soils and methods for demonstrating cleaning efficacyTЯXf8EW3E hFW3bpEW3€EW3ˆEW3FW3pEW3pEW3‚ЯInformation technology — Security techniques — Code of practice for information security management-Deuxiшme щditionTЯtf8Eш3E hFш3bpEш3€Eш3ˆEш3Fш3pEш3pEш3‚ЯInformation technology — Security techniques — Code of practice for information security management-Deuxiшme щditionTЯtf8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3ЯInformation technology - Security techniques - Information security management systems - Requirements-First EditionTЯsf8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3ЯIneormation technology — Security techniques — Code of practice for information security management-First EditionTЯqf 8EW3E hFW3bpEW3€EW3ˆEW3FW3pEW3pEW3yЯSpecification for Quality Programs for the Petroleum, Petrochemical and Natural Gas Industry-Eighth EditionTЯkf 8Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3iЯEarth-moving machinery Basic types Identification and terms and definitions-Fifth EditionTЭ[f 8Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3pEp3ЯFoodstuffs - Determination of vitamin A by high performance liquid chromatography - Part 1: Measurement of all-trans-retinol and 13-cis-retinolTЯf8EИ3E hFИ3bpEИ3€EИ3ˆEИ3FИ3pEИ3†ЯFoodstuffs - Determination of vitamin A by high performance liquid chromatography - Part 2: Measurement of beta-caroteneTЯxf8EИ3E hFИ3bpEИ3€EИ3‰EИ3FИ3pEИ3pEИ3Q ЯPipe Bending Methods, Tolerances, Process and Material RequirementsT ЯCf8EjE hFjbpEj€EjˆEjFjpEjn ЯChaussures De Protection-Cinquieme Edition; Mise A Jour No 1; Mise a Jour No 2; Mise A Jour No 3T Я`f8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧМ ЯConformity assessment Requirements for bodies providing audit and certification of management systems-First Editiom; Replaces ISO/IEC Guide 62:1996 and ISO/IEC Guide 66:1999T ЯЎf8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧpEЧl ЯGeneral requirements for the competence of testing and calibration laboratories-Second editionT Я^f8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3n ЯMedical devices Quality management systems Requirements for regulatory purposes-Second EditionT Я`f8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧpEЧTЯ<Natural Gas and Propane Installation Code-Thirteenth Edition[ЯSupplement No. 1 Natural gas and propane installation code-Thirteenth EditionTЯMf8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3TЯ)Natural gas and propane installation codeTЯPropane storage and handling code-Ninth Edition; Supplement 1: 01/2007TЯFf!8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧpEЧTЯ;Quality management systems — Requirements-Quatriшme щditiones_TЯ;Quality management systems — Requirements-Quatriшme щditiones_TЯ8Quality Management Systems - Requirements-Fourth EditionTЯ;Quality management systems — Requirements-Quatriшme щditiones_pЯProsthetics and Orthotics - Vocabulary - Part 3: Terms Relating to External Orthoses First EditionTЯbf'8EjE hFjapEj€EjˆEjFjpEjpEjpЯProsthetics and Orthotics - Vocabulary - Part 3: Terms Relating to External Orthoses First EditionTЯbf)8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3TЯ;Quality management systems — Requirements-Quatriшme щditionUЯSeamless and welded steel tubes - Dimensions and masses per unit lengthTЯGf,8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧiЯProduct Safety Information in Product Manuals, Instructions, and Other Collateral MaterialsTЯ[f.8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧpEЧtЯWasher-disinfectors – Part 1: General requirements, terms and definitions and tests-(ISO 15883-1):2006TЯff08EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧpEЧЯFoodstuffs - Determination of vitamin D by high performance liquid chromatography - Measurement of cholecalciferol (D3) and ergocalciferml (D2)TЯf28EыE hFыbpEы€EыˆEыFыpEы”ЯWasher-disinfectors - Part 3: Requirements and tests for washer-disinfectors employing thermal disinfection for human waste containersTЯ†f48EыE hFыbpEы€EыˆEыFыpEыpEыœЯFoodstuffs - Determination of vitamin E by high performance liquid chromatography - Measurement of alpha-, beta-, gamma- and delta-tocopherolsTЯŽf68EЬ3E hFЬ3bpEЬ3€EЬ3ˆEЬ3FЬ3pEЬ3‘ЯAnimal and vegetable fats and oils - Determination of tocopherol and tocotrienol contents by high-performance liquid chromatographyTЯƒf88EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧpEЧ‘ ЯAnimal and vegetable fats and oils - Determination of tocopherol and tocotrienol contents by high-performance liquid chromatographyT Яƒf:8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3T!ЯCarpet Materials (Non-Floor)?€?€?€?€?T"Я0Formed Carpet Materials (Trunk/Rear Compartment)€?€?T#ЯCarpet Materials (Non-Floor)a$ЯEnvironmental management systems Requirements with guidance for use-Second EditionT$ЯSf?8EЬ3E hFЬ3bpEЬ3€EЬ3ˆEЬ3FЬ3pEЬ3pEЬ3T%Я8Quality Management Systems - Requirements-Fourth EditionX&ЯFLAT-PLATE PHOTOVOLTAIC MODULES AND PANELS-FIRST EDITION; Amended: 10/2001T&ЯJfB8EыE hFыbpEы€EыˆEыFыpEыQ'ЯPipe Bending Methods, Tolerances, Process and Material RequirementsT'ЯCfD8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓT(Я8Quality Management Systems - Requirements-Fourth EditionT)Я8Quality Management Systems - Requirements-Fourth EditionQ*ЯCastings, Classification and Inspection of-Superseding AMS-STD-2175T*ЯCfH8EW3E hFW3bpEW3€EW3ˆEW3FW3pEW3+Я2+ЯISO STANDARDS COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISO 14001, 14004, 14010, 14011, 14012, DIS 14015, 14020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041, 14042, 14043, TR 14049, 14050, AND TR 14061; SEE ALSO ISO 14000 SERIES AND CDT+Я$fJ8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧW3pEW3а488 lш @-0hў0јќ0 P 0a @<= 8џ0Pџ0Аў00"8h*8Иў0јў0№?0јTѓW3ƒPO00Ш0lл @рі/џџџџlл Xџ00Ў0xЎ0№Ў0hЏ00§№PU(п­KњІRў­Y­YјЄPќЈУ2оBюZiЁMф;ч“#Я_ ЗcЛ g  П d  М N њ Ž : ~ * МhУ=щLј;Тnя›ЦD№nД`џO˜йM#g 1н$T,Я;Quality management systems — Requirements-Quatriшme щditiona-ЯEnvironmental management systems Requirements with guidance for use-Second EditionT-ЯSg8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧpEЧT.ЯQuality Management Systems - Fundamentals and Vocabulary-Third EditionT.ЯFg8Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3T/Я8Quality Management Systems - Requirements-Fourth Editionies_T0Я8Quality Management Systems - Requirements-Fourth EditionT1Я SAFETY MANUAL?€?€?€?€?€?2ЯGeneral Requirements for Bodies Operating Product Certification Systems-First Edition; Cancels and Replaces ISO/IEC Guide 40: 1983T2Я‚g8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧo3ЯAonformity assessment Guidance on a third-party certification system for products-Second EditionT3Яag 8EjE hFjbpEj€EjˆEjFjpEjo4ЯConformity assessment Guidance on a third-party certification system for products-Second EditionT4Яag 8EЧE hFЧbpEЧ€EЧˆEЧFЧpEЧpEЧ‰5ЯMethods of Indicating Conformity with Standards for Third-Party Certification Systems-First Edition; SANZ/SAA HB18.23: 1991T5Я{g8Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3f6ЯEnvironmental management Life cycle assessment Principles and framework-Second EditionT6ЯXg8Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3pEp3h7ЯEnvironmental management Life cycle assessment Requirements and guidelines-First EditionT7ЯZg8ErE hFrbpEr€ErˆErFrpErh8ЯEnvironmental management Life cycle asqessment Requirements and guidelines-First EditionT8ЯZg8ErE hFrbpEr€ErˆErFrpErpErh9ЯEnvironmental management Life cycle assessment Requirements and guidelines-First EditionT9ЯZg8Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3pEp3T:Я:Safety of machinery - Risk assessment - Part 1: Principles€?;ЯPackaging machines safety - Part 1: Terminology and classification of packaging machines ane associated equipmentT;Яqg8EЬ3E hFЬ3bpEЬ3€EЬ3ˆEЬ3FЬ3pEЬ3Q<ЯSafety of packaging machines - Part 3: Form, fill and seal machinesT<ЯCg8EЬ3E hFЬ3bpEЬ3€EЬ3ˆEЬ3FЬ3pEЬ3pEЬ3Q=ЯSafety of packaging machines - Part 3: Form, fill and seal machinesT=ЯCg8ErE hFrbpEr€ErˆErFrpErpErT>Я:Safety of machinery - Risk assessment - Part 1: Principleses_h?ЯEnvironmental management Life cycle assessment Requirements and guidelines-First EditionT?ЯZg 8Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3pEp3T@Я;Quality management systems — Requirements-Quatriшme щdition?жAЯGuidelines for Quality and/or Environmental Management Systems Auditing-First Edition; Replaces ISO 10011-1:1990, ISO 10011-2:1991, ISO 10011-3:1991, ISO 14010:1996, ISO 14011:1996, and ISO 14012:1996TAЯШg#8ErE hFrbpEr€ErˆErFrpErgBЯGlass in building - Determination of thermal transmittance (U-value) - Calculation methodTBЯYg%8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓgCЯGlass in building - Determination of thermal transmittance (U-value) - Calculation methodTCЯYg'8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3gDЯGlass in building - Determination of thermal transmittance!(U-value) - Calculation methodTDЯYg)8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓgEЯGlass in building - Determination of thermal transmittance (U-value) - Calculation methodTEЯYg+8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3pE_3gFЯGlass in building - Determination of thermal transmittance (U-value) - Calculation methodTFЯYg-8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3pE_3gGЯGlass in auilding - Determination of thermal transmittance (U-value) - Calculation methodTGЯYg/8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓgHЯGlass in building - Determination of thermal transmittance (U-value) - Calculation methodTHЯYg18Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3gIЯGlass in building - Determination of thermal transmittance (U-value) - Calculation methodTIЯYg38EћE hFћbpEћ€EљˆEћFћpEћVJЯErgonomics Manual handling Part 1: Lifting and carrying-Premiшre щditionTJЯHg58E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3pE_3YKЯErgonomics — Manual handling — Part 2: Pushing and pulling-Premiшre щditionTKЯKg78E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3pE_3mLЯErgonomics — Manual handling — Part 3: Handling of low loads at high frequency-Premiшre щditionTLЯ_g98E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3pE_3VMЯErgonomics Manual handling Part 1: Lifting and carrying-Premiшre щditionTMЯHg;8ErE hFrbpEr€ErˆErFrpErYNЯErgonomics — Manual handling — Part 2: Pushing and pulling-Premiшre щditionTNЯKg=8EћE hFћbpEћ€EћˆEћFћpEћpEћmOЯErgonomics — Manual handling — Part 3: Handling of low loads at high frequency-Premiшre щditionTOЯ_g?8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3pE_3%PЯStandard Welding Procedure Specification (WPS) for Gas Tungsten Arc Welding Followed by Shielded Metal Arc Welding of Carbon Steel (M-1/P-1/S-1, Group 1 or 2), 1/8 Through 1-1/2 Inch Thick, ER70S-2 and E7018, As-Welded or PWHT Condition (Primarily Pipe Applications) Site LicenseTPЯgA8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3pE_3UQЯInformation technology - Coding of audio-visual!objects - Part 3: AudioTQЯGgC8ErE hFrbpEr€ErˆErFrpErpErPRЯAASHTO LRFD Bridge Design Specifications - SI Units-Fourth EditionTRЯBgE8ErE hFrbpEr€ErˆErFrpErpEr‹SЯInterim 2006 Standard Specifications for Structural Supports for Highway Signs, Luminaires and Traffic Signals-Fourth EditionTSЯ}gG8Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3‹TЯInterim 2006 Standard Specifications for Structural Supports for Highway Signs, Luminaires and Traffic Signals-Fourth EditionTTЯ}gI8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3PUЯAASHTO LRFD Bridge Design Specifications - SI Units-Fourth EditionTUЯBgK8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3VЯPVЯAASHTO LRFD Bridge Design Specifications - SI Units-Fourth EditionTVЯBgM8EjE hFjapEj€EjˆEjFjpEjs, Luminaires and Traffic Signals-Fourth EditionTTЯ}gI8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3UЯPUЯAASHTO LRFD Bridge Design Specifications - SI Units-Fourth Edition˜ РY7ЏћW 7@`7РY7ЯЭyюšЛkТnIѕˆ4л‡1нpУoХ^ ЃOш”-йrЗcќЈAэ  У o  Г _  К i  – B ю†2ЪvКTw#Д`ё ЙeНiД` џZ˜йіhrМ ^_oqrt}Бp8@ПџџйБ €О` ZЪяГxіi ї ^\j8o=О`ЪяГxЙ9j џ08&DtgSchemaOBJECT0 (NšDtgSchemaGUID{EA3E6268-D998-11CE-9454-00AA00A3F36E}{EA3E6268-D998-11CE-9454-00AA00A3F36E}0 (0@DtgSchemaNAMEDIAGRAM1DIAGRAM10 (+1DtgDSRefBYTES4404400)))9€DtgDSRefDATAщюk0 )-5DtgSchemaBYTES716871680***:€DtgSchemaDATAъюkџЪ‘` †`џЪяГx,Юk џЦщюлцАща­Q ЩW9а9jк ХH DRIVER=SQL Server;SERVER=PALCAN.SCC.CA;UID=sa;PWD=welcome;APP=MS SQLEM - Data Tools;WSID=CGI-011859;DATABASE=eSpecs;AutoTranslate=Yes€DIAGRAM1&LoginLogsdbo$RequestedItemsdboTщюИkkЃk k\А?д=PTъюmkЃk k\А?д=Pј‚2E(ƒ2EІ88 88 ƒ2EPƒ2E„2Eўџ ўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ§џџџўџџџ ўџџџ ўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ§џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџRoot Entryџџџџџџџџ ћШк Х€fџџџџџџџџџџџџoџџџџ CompObjџџџџџџџџџџџџ"aўџџџ  !ўџџџ#ўџџџ%&'()*+,-./012345678ўџџџўџџџ;<=>?@ўџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ§џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ(  €џџ}liњ?Хg„Mо€[ё•аА ЊНЫ\08+ йцАща­Q ЩW9pтNFЧ§в—CZ™OaЭгO­хг=РOyј1,C SDMвбŽc`—впHш™…PŠпбЂа`—Фо$,C QDMвбŽc`—впHцkЖŸ\ВЯКЈЊЂ0(„|Ѕ €b€S€Control3†0ўRelationship 'FK_RequestedItems_LoginLogs' between 'LoginLogs' and 'RequestedItems',Е €1i€DDSMabel4864Ѕ €Є€ €SchGrid1ќ!` LoginLogs8Ѕ €Ў€€SchGrid2№<2RequestedItemsrj%J В1*Q7*Q7Ш№<ШдаШ№fŒ%86›Ї(›Їџџџ€DBTahomaFK_RequestedItems_LoginLogs!C4Жh xV4LoginLogstems№`џџџT,,,4Y#^- rFXю „eЃe‘ЯЖh rЖh rЖЪrj%J ržАxV4\  dao LoginLogs!C4ЖЂxV4RequestedItems№`џџџT,,,4Y#J- rFXю „eЃe‘ЯЖЂ rЖЂ rЖЪrj%J ržАxV4f  dboRequestedItems0,1,1350,2,600,5,ўџ џџџџMicrosoft Forms 2.0 FormEmbedded Objectє9ВqViewMode:2 &sch_labels_visible d n9H‡а(ActiveTableViewMode1 TableViewMode:0D5,0,28DdsStreamџџџџ$?Schema UDV Default&џџџџџџџџџџџџ9DSREF-SCHEMA-CONTENTS,џџџџ:ИSchema UDV Default Post V66џџџџџџџџџџџџA4,0,1650,1,1350,2,600,5,900 TableViewMode:12,0,284,0,1650 TableViewMode:22,0,284,0,1650 TableViewMode:32,0,284,0,1650 TableViewMode:4>4,0,284,0,1650,12,1950,11,1200(DDˆа(ActiveTableViewMode1 TableViewMode:0D5,0,284,0,1650,1,1350,2,600,5,900 TableViewMode:12,0,284,0,1650 TableViewMode:22,0,284,0,1650 TableViewMode:32,0,284,0,1650 TableViewMode:4>4,0,284,0,1650,12,1950,11,1200H BOH‹dboFK_RequestedItems_LoginLogsРР+№fOЅH B n9(DDQ4 NaМџџџџцŒџv,@Вrl >ўлцАща­Q ЩW9а9jк ХH DRIVER=SQL Server;SERVER=PALCAN.SCC.CA;UID=sa;PWD=welcome;APP=MS SQLEM - Data Tools;WSID=CGI-011859;DATABASE=eSpecs;AutoTranslate=Yes€DIAGRAM1&LoginLogsdbo$RequestedItemsdbo ;У №• TXh€lnwyAYUXHAAAAAAAAAAA1002„юo%ELECULACTV-CURREN00ТMt6 №• TWg€iktvGCXKSAAAAAAAAAAA10B…юo'HCULACTV-CURREN00УMи`5mК №• TWg€kmvxGCXKSAAAAAAAAAAA10B†юo)ELECULACTV-CURREN00ФMиj+ђ2№• TWg€kmvxGCXKSAAAAAAAAAAA10B‡юo+ELECULACTV-CURRENБ9УJУ<Е.Ї ™œœЂ)А5К<О@УJбXпfэrљ €  Ž  š  І + А 5 Й@И0Е:ПDЫPЯVиXи_ф`12ѕеnЩB@€01ёёџџю‰цqšю‰цqš р?xml01ю‰цqšю‰цqš рEbigint01­­@ю‰цqšю‰цqš рEbinary01hhю‰цqšю‰цqš р?bit01ЏЏ@а4ю‰цqšю‰цqš рAchar01==ю‰цqšю‰цqš рIdatetime01jj&&ю‰цqšю‰цqš рGdecimal01>>5ю‰цqšю‰цqš рCfloat01""ю‰цqšю‰цqš рCimage0188 ю‰цqšю‰цqš р?int01<<ю‰цqšю‰цqš рCmoney01яя@а4ю‰цqšю‰цqš рCnchar01ccа4ю‰цqšю‰цqš рCntext01ll&&ю‰цqšю‰цqš рGnumeric01чч@а4ю‰цqšю‰цqš рInvarchar01;;ю‰цqšю‰цqš рAreal01::ю‰цqšю‰цqš рSsmalldatetime0144ю‰цqšю‰цqš рIsmallint01zz ю‰цqšю‰цqš рMsmallmoney01bbPю‰цqšю‰цqš рOsql_variant01ча4ю‰цqšю‰цqš рGsysname01##а4ю‰цqšю‰цqš рAtext01ННю‰цqšю‰цqš рKtimestamp0100ю‰цqšю‰цqš рGtinyint01$$ю‰цqšю‰цqš рYuniqueidentifier01ЅЅ@ю‰цqšю‰цqš рKvarbinary01ЇЇ@а4ю‰цqšю‰цqš рGvarchargrantorintlИh${typendecharddeLш((г(Аh$(`$charLatin1_General_CI_AS_KS_WScharШi$јh$№h$typecharШi${statecharLш((г(Рi$(`$џџџџcharLatin1_General_CI_AS_KS_WSџџcharj$j$ statechar{(`$8"џP$џt" ыШ Hj$џџџџ0N%P$џј~€d$ џџџџа48n$Pp$Hq$`s$јl$Xo$@r$m$РQ* R*€d$ **ho$Ш&ˆ!ФHj$P$џШ Hj$џџџџ P%Ш&ˆ!ФHj$P$џШ Hj$џџџџШ&Pi$p0$а0$ј~h$Xe$а0$џџџџа44@n$РQ* R**Xe$Ш&ˆ!ФHj$P$џШ&ˆ!ФHj$P$џШ Hj$џџџџШ&Pi$p0$а0$ј~(f$ џџџџа4`o$РQ* R*(f$ Ш&ˆ!ФHj$P$џШ&ˆ!ФHj$P$џј~g$џџџџа4Xp$РQ* R*g$Ш&ˆ!ФHj$P$џШ&ˆ!ФHj$P$џј~иg$џџџџа4Pq$РQ* R*иg$Ш&ˆ!ФHj$P$џШ&ˆ!ФHj$P$џј~№h${$џџџ§а4Hr$РQ* R*$№h$~$**Ш&ˆ!ФHj$P$џШ&ˆ!ФHj$P$џШ Hj$џџџџШ&p0$а0$P$џј~ j$ џџџџа4$hs$РQ* R*`e$j$ Ш&ˆ!ФHj$P$џШ&ˆ!ФHj$P$џ`e$ Ш&ˆ!Фиo$P$џШ&ˆ!Фиo$P$џј~Pf$џџџџа4Шt$РQ* R*Pf$Ш&ˆ!Фиo$P$џШ&ˆ!Фиo$P$џШ иo$џџџџp0$а0$ј~@g$ џџџџа4шu$РQ* R*@g$ Ш&ˆ!Фиo$P$џШ&ˆ!Фиo$P$џШ иo$џџџџp0$а0$ј~@h$ џџџџа4w$РQ* R*@h$ Ш&ˆ!Фиo$P$џШ&ˆ!Фиo$P$џШ иo$џџџџp0$а0$ј~8i$џџџџа4(x$РQ* R*8i$Ш&ˆ!Фиo$P$џШ&ˆ!Фиo$P$џј~(j$ џџџџа4 y$РQ* R*(j$ Ш&ˆ!Фиo$P$џШ&ˆ!Фиo$P$џј~k$џџџџа4z$РQ* R*k$Ш&ˆ!Фиo$P$џШ&ˆ!Фиo$P$џј~№k$ џџџџа4{$РQ* R*№k$ Ш&ˆ!Фиo$P$џШ&ˆ!Фиo$P$џј~шl$џџџџа4|$РQ* R*шl$Ш&ˆ!Фиo$P$џШ&ˆ!Фиo$P$џШ иo$џџџџp0$а0$ј~№m$џџџџа4(}$РQ* R*№m$Ш&ˆ!Фиo$P$џШ&ˆ!Фиo$P$џј~аn$џџџџа4 ~$РQ* R*аn$Ш&ˆ!Фиo$P$џШ&ˆ!Фиo$P$џј~˜o$џџџџа4$РQ* R*˜o$Ш&ˆ!Фиo$P$џШ&ˆ!Фиo$P$џа`AXhфŽCŸ4Чђ)„9ЉўW˜ПыЃъ|џG˜йS-o 7I€TnюS_EŠ  Ў?д=PToю8Restricted and Reportable Substances for Parts-Engl/JapnTpю/Procedure for Testing Flammability of MaterialsEngl/JapnTqюFlammability of Materialsmmability of MaterialsEngl/JapnTrю+Label, Pressure Sensitive, For Interior UseialsEngl/JapnasюEnvironmental management systems Requirements with guidance for use-Second EditionTsюSooŠ  Ў?д=PatюEnvironmental management systems Requirements with guidance for use-Second EditionTtюSooŠ  Ў?д=PauюEnvironmental management systems Requirements with guidance for use-Second EditionTuюSo o‰  Ў?д=PavюEnvironmental management systems Requirements with guidance for use-Second EditionTvюSo oŠ  Ў?д=PЩwюASD Manual V.#1: Manual of Steel Construction Allowable Stress Design V.#2: Manual of Steel Construction Connections-See AISC M016 for Volume 1 and AISC M017 for Volume 2; Bib Record onlyTwюЛo oŠ  Ў?д=PTxю!RINGS, BREECH, STEEL FORGINGS FORterior UseialsEngl/JapnTyю;INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-10th EditionэzюGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, Durability, and Performance Requirements-Engl; Revision CTzюпooŠ  Ў?д=Pб{юNonferrous Metals-Nickel, Cobalt, Lead, Tin, Zinc, Cadmium, Precious, Reactive, Refractory Metals and Alloys; Materials for Thermostats, Electrical Heating and Resistance Contacts, and ConnectorsT{юУooŠ  Ў?д=PT|ю;INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-10th Editionj}юISO 9000 COLLECTION 1 FRENCH-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004T}ю\ooŠ  Ў?д=Pj~юISO 9000 COLLECTION 1 FRENCH-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004T~ю\ooŠ  Ў?д=PjюISO 9000 COLLECTION 1 FRENCH-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004Tю\ooŠ  Ў?д=Pj€юISO 9000 COLLECTION 1 FRENCH-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004T€ю\ooŠ  Ў?д=PcюISO 9000 COLLECTION 1-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004TюUooŠ  Ў?д=Pj‚юISO 9000 COLLECTION 1 FRENCH-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004T‚ю\o oŠ  Ў?д=PjƒюISO 9000 COLLECTION 1 FRENCH-INCLUDES THE 2001 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004Tƒю\o"oŠ  Ў?д=PГ„юUL Standard for Safety Electrically Operated Valves for Use in Hazardous (Classified) Locations-Sixth Edition; Reprint with Revisions Through and Including 4/13/1999T„юЅo$oŠ  Ў?д=P‰…юUL Standard for Safety Fire Tests of Door Assemblies-Ninth Edition; Reprint with Revisions Through and Imcluding 10/05/2001T…ю{o&oŠ  Ў?д=P‰†юUL Standard for Safety Fire Tests of Door Assemblies-Ninth Edition; Reprint with Revisions Through and Including 10/05/2001T†ю{o(oŠ  Ў?д=P‰‡юUL Standard for Safety Fire Tests of Door Assemblies-Ninth Edition; Reprint with Revisions Through and Including 10/05/2001T‡ю{o*oŠ  Ў?д=PƒˆюUL Standard for Safety Tin-Clad Fire Doors-Twentieth Edition; Reprint with Revisions Through and Including 03/21/2003Tˆюuo,oŠ  Ў?д=Pƒ‰юUL Standard for Safety Tin-Clad Fire Doors-Twentieth Edition; Reprint with Revisions Through and Including 03/21/2003T‰юuo.oŠ  Ў?д=P‰ŠюUL Standard for Safety Fire Tests oe Door Assemblies-Ninth Edition; Reprint with Revisions Through and Including 10/05/2001TŠю{o0oŠ  Ў?д=PQ‹юREGULATOR, ENGINE GENERATOR; 28-VOLT DIRECT CURRENT, VIBRATING TYPET‹юCo2oŠ  Ў?д=P‰ŒюUL Standard for Safety Fire Tests of Door Assemblies-Ninth Edition; Reprint with Revisions Through and Including 10/05/2001TŒю{o4oŠ  Ў?д=PTю9UL Standard for Safety for Fire Pump Motors-First EditiononoŽюStandard Test Procedure for AC High-Voltage Circuit Breakers Rated on a Symmetrical Current BasisTŽюao7oŠ  Ў?д=PюUL Standard for Safety Flexible Metal Conduit-Tenth Edition; Reprint with Revisions through and Including 7/30/2004Tюso9oŠ  Ў?д=P­юInformation technology Radio frequency identification for item management Part 7: Parameters for active air interface communications at 433 MHz-First EditionTюŸo;oŠ  Ў?д=P­‘юInformation technology Radio frequency identification for item management Part 7: Parameters for active air interface communications at 433 MHz-First EditionT‘юŸo=oŠ  Ў?д=P­’юInformation technology Radio frequency identification for item management Part 7: Parameters for active air interface communications at 433 MHz-First EditionT’юŸo?oŠ  Ў?д=P­“юInformation technology Radio frequency identification for item management Part 7: Parameters for active air interface communications at 433 MHz-First EditionT“юŸoAoŠ  Ў?д=P­”юInformation technology Radio frequency identification for item management Part 7: Parameters for active air interface communications at 433 MHz-First EditionT”юŸoCoŠ  Ў?д=P•ю­•юInformation technology Radio frequency identification for item management Part 7: Parameters for active air interface communications at 433 MHz-First EditionT•юŸoEoŠ  Ў?д=Por active air interface communications at 433 MHz-First EditionT”юŸoCoŠ  Ў?д=P•юй,ЪЩШЧЦХD№-йPќЋWЮzїЃ ЬCяf‰5‚.Ф p  В O ћ ‘ = г   С W  ЏоŠIѕЁи„#ЯnЙeА\Д`џH˜йapч„kНяGeneral Requirements for the Competence of Testing and Calibration Laboratories-First EditionTНя]ppёp p|БVд=PTОя7Standard Guide for Sampling Chain-Of-Custody ProceduresКЉ@cПяISO 9000 COLLECTION 1-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004TПяUppp p|Б?д=PАРяAerospace series - Titanium and titanium alloy remelting stock and castings; technical specification - Part 1: General requirements; German version EN 2545-1:1995TРяЂppp p|БŽд=PЋСяAerospace series - Titanium and titanium alloy remelting stock and castings; technical specification - Part 2: Remelting stock; German version EN 2545-2:1995TСяpp p p|БŽд=PУТяAerospace series - Titanium and titanium alloy remelting stock and castings; technical specification - Part 3: Pre-productions and production castings; German version EN 2545-3:1995TТяЕp p p p|БŽд=PУя(DRAFT) Aerospace series - Metallic materials; test methods - Part 16: Non-destructive testing, penetrant testingTУяqp p q p|Бд=PФя(DRAFT) Aerospace series - Metallic materials; test methods - Part 16: Non-destructive testing, penetrant testingTФяqp pp p|Бд=PSХяWood Flush Doors-First Consolidated Edition; General Instruction No 1TХяEppp p|Бд=PUЦяPrinted Boards Part 2: Test Methods-Third Edition; Amendment 1: 06/1992TЦяGppp p|Б?д=P{ЧяMeasurement Management Systems - Requirements for Measurement Processes and Measuring Equipment-First EditionTЧяmpp*p p|Бд=P`ШяInformation and Documentation - Records Management - Part 1: General-First EditionTШяRpp.p p|Б?д=P˜ЩяGeneral Requirements for the Competence of Testing amd Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TЩяŠpp5p p|БŽд=P˜ЪяGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TЪяŠpp7p p|Б?д=P˜ЫяGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Editiom; Cancels and Replaces ISO/IEC Guide 25: 1990TЫяŠpp9p p|Б?д=P˜ЬяGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TЬяŠpp=p p|БŽд=PTря9Passenger Car Tyres and Rims - Part 2: Rims-Third EditionВ?@^сяShipbuilding - Inland Navigation - Raft-Type Life-Saving Apparatus First EditionTсяPp pmp p|Б?д=P^тяShipbuilding - Inland Navigation - Raft-Type Life-Saving Apparatus First EditionTтяPp"pop p|БŽд=PуяGeometrical Product Specifications (GPS) - Standard Reference Temperature for Geometrical Product Specification and Verification-Second EditionTуяp$psp p|БŽд=PTфя3UNIT HEATER, AIR-CIRCULATING, STEAM (SHIPBOARD USE)‹хяSI Units and Recommendations for the Use of Their Multiples and of Certain Other Units-Third Edition; Amendment 1: 11-01-1998Tхя}p'pyp p|Б?д=PQцяCastings, Classification and Inspection of-Superseding AMS-STD-2175TцяCp)p}p p|Бд=PcчяGuieelines for Quality and/or Environmental Management Systems Auditing-First EditionTчяUp+p…p p|БŽд=P€шяInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340Tшяrp-pŠp p|Б?д=P€щяInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340Tщяrp/pŒp p|Б?д=P€ъяInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340Tъяrp1pp p|Бд=P€ыяInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340Tыяrp3p”p p|Бд=P€ьяInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340Tьяrp5p˜p p|Бд=P‹эяSI Units and Recommendations for the Use of Their Multiples and of Certain Other Units-Third Edition; Amendment 1: 11-01-1998Tэя}p7pžp p|Б?д=P‹юяSI Units and Recommendations for the Use of Their Multiples and of Certaim Other Units-Third Edition; Amendment 1: 11-01-1998Tюя}p9p p p|БŽд=PwяяRubber, raw natural Guidelines for the specification of technically specified rubber (TSR)-Sixth EditionTяяip;pЄp p|БŽд=PT№я.Comparison in Rating Trends in AGMA versus ISOMРN O0ЮM4ВКЉ@Tёя.Comparison in Rating Trends in AGMA versus ISOMРN O0ЮM4ВКЉ@˜ђяGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TђяŠp?pЎp p|Бд=P‹ѓяSI Units and Recommendations for the Use of Their Multiples and of Certain Other Units-Third Edition; Amendment 1: 11-01-1998Tѓя}pApВp p|Бд=PzєяQuality management Customer satisfaction Guidelines for complaints handling in organizations-First EditionTєяlpCpЫp p|Б?д=PѕяGeometrical Product Specifications (GPS) - Standard Reference Temperature for Geometrical Product Specification and Verification-Second EditionTѕяpEpбp p|БŽд=Pія‹іяSI Units and Recommendations for the Use of Their Multiples and of Certain Other Units-Third Edition; Amendment 1: 11-01-1998Ыp p|Б?д=PѕяѕяGeometrical Product Specifications (GPS) - Standard Reference Temperature for Geometrical Product Specification and Verification-Second EditionTѕяpEpбp p|БŽд=P’0“?Хqц’њІRў‡3ЈTЩuѕЁ!ЭMљy%ЅQюšIѕjТ%бsС m   - • A Љ U Н i Е:ц‘=ъ–УD№-й.к*жsЫ`џF˜йO3q 7Ж1TCБ–юInformation technology Radio frequency identification for item management Part 6: Parameters for air interface communications at 860 MHz to 960 MHz-First EditionT–юЃqqŠ  Ў?д=Pi—юPerformance Standards in Building - Contents and Presentation First Edition; (Erratum-1981)T—ю[qqŠ  Ў?д=P}˜юPerformance Standards in Building - Principles for Their Preparation and Factors to Be Considered First EditionT˜юoqqŠ  Ў?д=PT™ю=Graphical Symbols for Use in the Labelling of Medical DevicesTšю<Aluminium Alloy Castings - Radiography Testing-First Editionsб›юNonferrous Metals-Nickel, Cobalt, Lead, Tin, Zinc, Cadmium, Precious, Reactive, Refracuory Metals and Alloys; Materials for Thermostats, Electrical Heating and Resistance Contacts, and ConnectorsT›юУqqŠ  Ў?д=PjœюISO 9000 COLLECTION 1 FRENCH-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004Tœю\q qŠ  Ў?д=PTю)Quality Management Systems - Requirementssting-First EditionsTžю%YOKE-ADAPTER, COMPRESSED EAS CYLINDERentssting-First EditionsTŸю%YOKE-ADAPTER, COMPRESSED GAS CYLINDERentssting-First Editions˜ юGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T юŠqqŠ  Ў?д=PpЁюInformation technology - Code of practice for information security management (ISO/IEC 17799:2000)TЁюbqqŠ  Ў?д=PTЂю;INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-10th EditionnsжЃюGuidelines for Quality and/or Environmental Management Systems Auditing-First Edition; Replaces ISO 10011-1:1990, ISO 10011-2:1991, ISO 10011-3:1991, ISO 14010:1996, ISO 14011:1996, and ISO 14012:1996TЃюШqqŠ  Ў?д=PjЄюISO 9000 COLLECTION 1 FRENCH-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO!9001, AND ISO 9004TЄю\qqŠ  Ў?д=P€ЅюInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340TЅюrqqŠ  Ў?д=P€ІюInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340TІюrqqŠ  Ў?д=P€ЇюInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340TЇюrqqŠ  Ў?д=PЬЈюInformation technology equipment - Radio disturbance characteristics - Limits and methods of measurement-Includes amendments A1:2000 and A2:2003; CISPR 22:1997, + A1:2000 + A2:2002, modifiedTЈюОqqŠ  Ў?д=PaЉюEnvironmental management systems Requirements with guidance for use-Second EditionTЉюSq qŠ  Ў?д=PsЊюEnvironmental Management Systems - Specification with Guidance for Use-ISO 14001:2004; Second EditionTЊюeq"qŠ  Ў?д=PsЋюEnvironmental Management Systems - Specification with Guidance for Use-ISO 14001:2004; Second EditionTЋюeq$qŠ  Ў?д=PЭЌюMaritime Navigation and Radiocommunication Equipment and Systems - Shipborne Voyage Data Recorder (VDR) - Performance Requirements - Methods of Testing and Required Test Results-First EditionTЌюПq&qŠ  Ў?д=PЭ­юMaritime Navigation and Radiocommunication Equipment and Systems - Shipborne Voyage Data Recorder (VDR) - Performance Requirements - Methodq of Testing and Required Test Results-First EditionT­юПq(qŠ  Ў?д=PTЎю?Restricted and Reportable Substances for Parts-Engl; Revision FƒЏюQuality Management Systems - Fundamentals and Vocabulary-Second Edition; Supersedes ISO 9000-1:1994 and ISO 8402:1994TЏюuq+qŠ  Ў?д=PƒАюQuality Management Systems - Fundamentals and Vocabulary-Second!Edition; Supersedes ISO 9000-1:1994 and ISO 8402:1994TАюuq-qŠ  Ў?д=P˜БюGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TБюŠq/qŠ  Ў?д=PВюUL Standard for Safety Flexible Metal Conduit-Tenth Edition; Reprint with Revisions through and Including 7/30/2004TВюsq1qŠ  Ў?д=PoГюSeries 1 freight containers -- Handling and securing (ISO 3874:1997, incl. Amd:2000 and Amd:2002)TГюaq3qŠ  Ў?д=PrДюAnaesthetic and Respiratory Equipment - Conical Connectors - Part 1: Cones and Sockets-Third EditionTДюdq5qŠ  Ў?д=PcЕюGuidelines for Quality and/or Environmental Management Systems Auditing-First EditionTЕюUq7qŠ  Ў?д=P˜ЖюGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TЖюŠq9qŠ  Ў?д=PoЗюBasic Environmental Testing Procedures Part 2: Tests - Tests Eb and Guidance: Bump-Second EditionTЗюaq;qŠ  Ў?д=PdИюStandard Classification System for Rubber Products in Automotive Applications-SAE J200TИюVq=qŠ  Ў?д=P|ЙюUL Standard for Safety Information Technology Equipment Safety Part 21: Remote Power Feeding-First EditionTЙюnq?qŠ  Ў?д=P™КюCLEANROOMS AND ASSOCIATED CONTROLLED ENVIRONMENTQ SET-INCLUDES: ISO 14644-1, ISO 14644-2, ISO DIS 14644-3, ISO 14644-4, AND ISO DIS 14644-5TКю‹qAqŠ  Ў?д=PvЛюBIOLOGICAL EVALUATION OF MEDICAL DEVICES SET-INCLUDES ISO 10993-1 THRU ISO 10993-17 and ISO DIS 10993-18TЛюhqCqŠ  Ў?д=PМю­МюAcoustics - Determination of sound power levels of noise sources using sound intensity - Part 3: Precision method for measurement by scanning (ISO 9614-3:2002)  Ў?д=PЛюvЛюBIOLOGICAL EVALUATION OF MEDICAL DEVICES SET-INCLUDES ISO 10993-1 THRU ISO 10993-17 and ISO DIS 10993-18TЛюhqCqŠ  Ў?д=P88 XПND—ˆПND]ШПND†$ЎZСmё9хv"Š6г ЙJіu!‰5В^л‡3fEё~*ЗcЎ т Ž  К : ц f  Ј T ~*жfz&в~*Рl›GѓŸ"Юe`џH˜йA=r 7TСTМюŸqEŠ  Ў?д=PaНюPare-Vapeur En Feuille De Polyethylene Pour Batiments;-Modificatif 1: Novembre 1988TНюSrrŠ  Ў?д=PaОюPare-Vapeur En Feuille De Polyethylene Pour Batiments;-Modificatif 1: Novembre 1988TОюSrrŠ  Ў?д=PaПюPare-Vapeur En Feuille De Polyethylene Pour Batiments;-Modificatif 1: Novembre 1988TПюSrrŠ  Ў?д=PaРюPare-Vapeur En Feuille De Polyethylene Pour Batiments;-Modificatif 1: Novembre 1988TРюSrrŠ  Ў?д=PaСюPare-Vapeur En Feuille De Polyethylene Pour Batiments;-Modificatif 1: Novembre 1988TСюSr rŠ  Ў?д=PЪТюAssembly Tools for Screws and Nuts - Hand Torque Tools - Requirements and Test Methods for Design Conformance Testing, Quality Conformance Testing and Recalibration Procedure-Third EditionTТюМr rŠ  Ў?д=PfУюCode for Power Press Operation: Health, Safety, and Guarding Requirements-Fourth EditionTУюXr rŠ  Ў?д=P€ФюInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340TФюrrrŠ  Ў?д=P^ХюQuality Management - Guidelines for Quality Plans-First Edition; ISO 10005: 1995TХюPrrŠ  Ў?д=PтЦюAssembly tools for screws and nuts Hand torque tools Requirements and test methods fmr design conformance testing, quality conformance testing and recalibration procedure-Supersedes EN 26789:1994; ISO 6789:2003TЦюдrrŠ  Ў?д=PИЧю(DRAFT) Safety of machinery - Safety-related parts of control systems - Part 1: General principles for design (ISO/DIS 13849-1:2004); German version prEN ISO 13849-1:2004TЧюЊrrŠ  Ў?д=PZШюStandard For FLAME TESTS OF FLAME-RESISTANT FABRICS AND FILMS-Second EditionTШюLrrŠ  Ў?д=PЕЩюAcoustics - Determination of Sound Power Levels of Noise Sources Using Sound Intensity - Part 1: Measurement at Discrete Points First Edition (CEN EN ISO 9614-1: 1995)TЩюЇrrŠ  Ў?д=PЕЪюAcoustics - Determination of Sound Power Levels of Noise Sources Using Sound Intensity - Part!1: Measurement at Discrete Points First Edition (CEN EN ISO 9614-1: 1995)TЪюЇrrŠ  Ў?д=P”ЫюAcoustics - Determination of Sound Power Levels of Noise Sources Using Sound Intensity - Part 2: Measurement by Scanning First EditionTЫю†rrŠ  Ў?д=PЉЬюAcoustics - Determination of Sound Power Levels of Noise Sources Using Sound Intensity - Part 3: Precision Method for Measurement by Scanning-First EditionTЬю›rrŠ  Ў?д=PœЭюMedical Electrical Equipment Part 2-4: Particular Requirements for the Safety of Cardiac Defibrillators-Second Edition; Corrigendum 1: 04/2004TЭюŽr!rŠ  Ў?д=P_ЮюInformation Technology - Guideline for the Evaluation and Selection of CASE ToolsTЮюQr#rŠ  Ў?д=PŠЯюSafety Glazing Materials for Glazing Motor Vehicles and Motor Vehicle Equipment Operating on Land Highways - Safety StandardTЯю|r%rŠ  Ў?д=PTаюCriteria for Safety Symbolsubstances for Parts-Engl; Revision FTбюProduct Safety Signs and Labelsances for Parts-Engl; Revision FTвю?Restricted and Reportable Substances for Parts-Engl; Revision F Tгю,Electrolytically Deposited Metallic Coatingsts-Engl; Revision FTдюSafety Color CodeDeposited Metallic Coatingsts-Engl; Revision F›еюInformation technology Guidelines for the management of IT Security Part 5: Management guidance on network security-ISO/IEC TR 13335-5:2001Tеюr,rŠ  Ў?д=PŽжюInformation Technology - Guidelines for the Management of IT Security - Part 4: Selection oe Safeguards-ISO/IEC TR 13335-4: 2000Tжю€r.rŠ  Ў?д=PЃзюInformation Technology - Guidelines for the Management of IT Security - Part 3: Techniques for the Management of IT Security-ISO/IEC TR 13335-3: 1998Tзю•r0rŠ  Ў?д=P˜июInformation Technology - Guidelines for the Management of IT Security - Part 2: Managing and Planning IT Security-ISO/IEC TR 13335-2: 1997TиюŠr2rŠ  Ў?д=P˜йюInformation Technology - Guidelines for the Management of IT Security - Part 2: Managing and Planning IT Security-ISO/IEC TR 13335-2: 1997TйюŠr4rŠ  Ў?д=PšкюInformation Technology - Guidelines for the Management of IT Security - Part 1: Concepts and Models for IT Security-ISO/IEC TR 13335-1: 1996TкюŒr6rŠ  Ў?д=P™люAppareils Elevateurs D´Habitation Pour Personnes Handicapees-Deuxieme Edition; Fiche No 1; Modification No 2; Mise à jour no 2Tлю‹r8rŠ  Ў?д=PmмюAppareils Elevateurs Pour Personnes Handicapees-Quatrieme Edition; Fiche No 1; Mise A Jour No 2Tмю_r:rŠ  Ў?д=P]нюMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TнюOr<rŠ  Ў?д=PwоюProcedure for Certification of Factory-Built Houses-Fourth Edition; General Instruction No 1; Update No 2Tоюir>rŠ  Ў?д=PwпюProcedure for Certification of Factory-Built Houses-Fourth Edition; General Instruction No 1; Update No 2Tпюir@rŠ  Ў?д=PTрю?Restricted and Reportable Substances for Parts-Engl; Revision FTсю?Restricted and Reportable Substances for Parts-Engl; Revision FTтю?Restricted and Reportable Substances for Parts-Engl; Revision FTую8Restricted and Reportable Substances for Parts-Engl/Japnision FTфю?Restricted and Reportable Substances for Parts-Engl; Revision FхюaхюEnvironmental management systems Requirements with guidance for use-Second Editiond and Reportable Substances for Parts-Engl; Revision FTтю?Restricted and Reportable Substances for Parts-Engl; Revision FTую8Restricted and Reportable Substances for Parts-Engl/Japnision FTфю?Restricted and Reportable Substances for Parts-Engl; Revision мz&в~*ж_ ”@у"Ю5сGѓ[ox$–BЇSџЋWЏ%бr‚.… 1  I ” @ ‹ 7 н ‰ б}›Gщ•С[=щˆ4гЪiД`џ<{ ƒsoЌUЮ #)CAAAAAAAAAAMBRIBAAAAAAAAAAOHZHBAAAAAAAAAAPOADAAAAAAAAAAAQLVYAAAAAAAAAAARIGEBAAAAAAAAAASBNJBAAAAAAAAAATEFBAAAAAAAAAAUFTJBAAAAAAAAAAUABCAAAAAAAAAAWSGDBAAAAAAAAAAXLIACAAAAAAAAAAZDAIBAAAAAAAAAALNHBAAAAAAAAAAVBHZXAAAAAAAAAAACICEBAAAAAAAAAAEPOBBAAAAAAAAAAFLMIBAAAAAAAAAAGKHMCAAAAAAAAAAHAUJCAAAAAAAAAAISOIBAAAAAAAAAAJROBBAAAAAAAAAALDATAAAAAAAAAAAMWHCAAAAAAAAAAAPUPCAAAAAAAAAAAQGYIBAAAAAAAAAARZYCAAAAAAAAAAATELDAAAAAAAAAAAWBSACAAAAAAAAAAXAGGBAAAAAAAAAAZEQJBAAAAAAAAAAWAVRJBAAAAAAAAAACEXCAAAAAAAAAAADAYHBAAAAAAAAAAKTCAAAAAAAAAAAEPIJBAAAAAAAAAAFYXJBAAAAAAAAAAHKQJBAAAAAAAAAAPEBCAAAAAAAAAAJWIGBAAAAAAAAAAKHTGBAAAAAAAAAALLXXAAAAAAAAAAAMGHPCAAAAAAAAAANWNEBAAAAAAAAAAPMVOCAAAAAAAAAARFFGBAAAAAAAAAAUOEVCAAAAAAAAAAWFLIBAAAAAAAAAAXQOHBAAAAAAAAAAYTJCAAAAAAAAAAAXAEMMCAAAAAAAAAABYNIBAAAAAAAAAADDFGCAAAAAAAAAAEHSBCAAAAAAAAAAFKQJBAAAAAAAAAAHAMCCAAAAAAAAAAKEREAAAAAAAAAAALQYJAAAAAAAAAAAMZGNAAAAAAAAAAANQBJBAAAAAAAAAAOEIJBAAAAAAAAAATWCBAAAAAAAAAAPJHFBAAAAAAAAAAQANJBAAAAAAAAAANQLCAAAAAAAAAARQBJBAAAAAAAAAATIAJBAAAAAAAAAAUWTJBAAAAAAAAAAVQMACAAAAAAAAAAWDPJBAAAAAAAAAAFNBCAAAAAAAAAAYSGNAAAAAAAAAAAZUGACAAAAAAAAAAYBQBBCAAAAAAAAAACDFYBAAAAAAAAAADHMZBAAAAAAAAAAEILIBAAAAAAAAAAFDQGBAAAAAAAAAASBGCAAAAAAAAAAGYRJBAAAAAAAAAAHYNSAAAAAAAAAAAIYOHBAAAAAAAAAAJZVIBAAAAAAAAAALRHCAAAAAAAAAAANVGHCAAAAAAAAAAORSCAAAAAAAAAAAPKADBAAAAAAAAAAQOWCAAAAAAAAAAASNHJBAAAAAAAAAATENPAAAAAAAAAAAUKPJBAAAAAAAAAAVQGEBAAAAAAAAAAWIPCBAAAAAAAAAAXZCKAAAAAAAAAAAZMRXBAAAAAAAAAAZBWNEBAAAAAAAAAADIHQCAAAAAAAAAAEYVABAAAAAAAAAAGNAIBAAAAAAAAAARGCAAAAAAAAAAAHRXHBAAAAAAAAAAILNIBAAAAAAAAAAZPDBAAAAAAAAAAJURCCAAAAAAAAAAKTHACAAAAAAAAAALXXXAAAAAAAAAAANDXLCAAAAAAAAAAOSYPAAAAAAAAAAAQCUFBAAAAAAAAAAXPGBAAAAAAAAAARTTJBAAAAAAAAAASCREBAAAAAAAAAATZIHBAAAAAAAAAAUMGBCAAAAAAAAAAVFTJBAAAAAAAAAAWCPIDAAAAAAAAAATKIBAAAAAAAAAAXGXGCAAAAAAAAAAZCSHBAAAAAAAAAA @РР-<РKLZhРwx†Р”ƒ•ЃБРЯоэќ )8GРVWfu„“ЂБРЯоРэюќ (7FUdРstƒ’ЁРАБПЭлъљ‚&5DSbq€@ž„Ÿ­РЛМuЫкщјР…$3BQ`o~‚œРЋЌЛЪйшї$3BQ`o~œЋРКЛЩ@зицРєѕ"1@O^m|‹Рš› ЉИЧж@хцєР‚!0?N]l{Š™ˆЈЗРЦЧеуђР./Р>?M[jyˆ—ІЕФгтё   - @< = K РY Z Рi j x † • Є Г Т Рб ‚в р ю Ј§ Р    Њ * 9 H W Рf Рg ‚h v ‚„ Р“ ƒ” Ђ РА Б П Э м ы Рњ ћ ѓ Р  & 4 B РQ R ` n } РŒ  › Љ И Ч ж Рх ц ѕ   Р" # 1 ? N ] l { Š ™ Ј З Ц е ф ѓ Р  Ž  Р/ ‚0 Р? @ N \ k z ‰ ˜ Ї Ж Х д у Рђ ѓ -<KZiРxРyzˆ–ЅƒйДУвс№џ…Р,-;РЈЉI‚Wfu„Р“”ЂАПРЮРЯаоьРћќ '6ET„crР‚РžŸ­ЛЪРйкші@| Р$3BQ`o~РœЋЙРop§Ш‚зцРѕіЉР"#2РйкAOР^_m|‹šЉИЧ РжзхРѓє‚-<РKL[jyˆ—ІЕФгтёР-.<JРYZhРvwMР…†n”РЃ ЄГŒ" РТУбпю§ *9HWfРuvMР„…“ЁРАБРРСЯньyˆћ (7FUРdes‚ŸЎНРЬЭмыњРАБ &5DSbРqr€ŽœЋКЩ‚ичіРР$Р23AO^m|‚‹šЉИЧжРхцєР.@=>LРZ[jyˆ—ІЕФгтё‚-Р<=.KРZ[jРy‹zˆ–ЅРДЕУбряў +‚:IXgРvw†•ЄГТoбряўР *Р9:HVetƒР’†“ЁЏОРЭЮньћР  '6ETcrŸЎНЬлъљ@'6РE†FTbРqr€‚ŽЌЛЪРйкшРіїs#Р23ŽРABP^m=dО`џH˜йI{t ЁTхюSrGŠ  Ў?д=PцюEnvironmental Management Systems - General Guidelines on Principles, Systems and Support Techniques-ISO 14004:2004; Second EditionTцю‚ttŠ  Ў?д=P™ўюCLEANROOMS AND ASSOCIATED CONTROLLED ENVIRONMENTS SET-INCLUDES: ISO 14644-1, ISO 14644-2, ISO DIS 14644-3, ISO 14644-4, AND ISO DIS 14644-5Tўю‹ttt t|БVд=P€џюInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340Tџюrttt tВBд=P€яInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340Tяrttt tВBд=P€яInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340Tяrt tt tВVд=P€яInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340Tяrt t t t|БVд=PTяPerformance Standard for Rating Packaged Water Chillers-Second EditionTяFt t t tВVд=PaяEnvironmental management systems Requirements with guidance for use-Second EditionTяSttt t|Б?д=PaяEnvironmental management systems Requirements with guidance for use-Second EditionTяSttt t|Б?д=PaяEnvironmenual management systems Requirements with guidance for use-Second EditionTяSttt t|Бд=PaяEnvironmental management systems Requirements with guidance for use-Second EditionTяSttt t|Бд=PaяEnvironmental management systems Requirements with guidance for use-Second EditionTяSttt t|Бд=Pa яEnvironmental management systems Requirements with guidance for use-Second EditionT яSttt t|Бд=PqяQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994Tяctt-t tВд=Pn)яMedical devices Quality management systems Requirements for regulatory purposes-Second EditionT)я`ttBt tВ?д=PИ*яSafety requirements for electrical equipment for measurement, control, and laboratory use Part 1: General requirements-CORR 14512: September 19, 2003; IEC 61010-1: 2001;T*яЊttDt tВ?д=PИ+яSafety requirements for electrical equipment for measurement, control, and laboratory use Part 1: General requirements-CORR 14512: September 19, 2003; IEC 61010-19 2001;T+яЊt!tFt tВ?д=PИ,яSafety requirements for electrical equipment for measurement, control, and laboratory use Part 1: General requirements-CORR 14512: September 19, 2003; IEC 61010-1: 2001;T,яЊt#tHt tВ?д=PŸ-яNon-Incendive Electrical Equipment for Use in Class I, Division 2 Hazardous Locations Industrial Products-First Edition; General Instructiom No 1T-я‘t%tJt tВŽд=PŸ.яNon-Incendive Electrical Equipment for Use in Class I, Division 2 Hazardous Locations Industrial Products-First Edition; General Instruction No 1T.я‘t'tLt tВŽд=PT/я<Lighting Industrial Facilities-Errata - 2001; Errata 7/20/04аhhDT0я6Residential Telecommunications Infrastructure StandardГI4ВBКЉ@T1я6Residential Telecommunications Infrastructure StandardГI4ВBКЉ@T2я6Residential Telecommunications Infrastructure StandardГI4ВBКЉ@Ц3яLighting for Buildings Part 2: Code of Practice for Daylighting (AMD 7391) October 15, 1992 (Used in Conjunction with BS 8206: Part 1 Replaces BS DD 67: 1980 and BS DD 73: 1982)-Amd 1;T3яИt-tnt t|БVд=PT4я-Lighting of Indoor Work Places-Second Edition StandareГI4ВBКЉ@S5яLighting Handbook Reference & Application-9th Edition; Errata 7/29/04T5яEt0tst t|БBд=Pa6яTelecommunications Cabling Systems in Commercial Buildings-General Instruction No 1T6яSt2tut t|Бiд=P7яDetermination De La Puissance Requise Des Appareils De Chauffage Et De Refroidissement Residentiels-Deuxieme Edition; Fiche No 1-2T7я‚t4twt t|Бiд=P˜8яGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T8яŠt6tzt t|Бiд=P–9яTextile Test Methods Textiles Tests for Colourfastness Part C06: Colourfastness to Domestic and Commercial Laundering-ISO 105-C06:1994T9яˆt8tt t|БBд=PT:я9Textile Test Methods Colourfastness to Rubbing (Crocking)~;яTextile Test Methods Textile Fabrics - Determination of Resistance to Surface Wetting (Spray Test)-ISO 4920:1981T;яpt;tƒt t|БBд=P<яW<яTextile Test Methods Resistance to Pilling - Random Tumble Pilling TesterT<яIt=t…t t|БBд=P =я†=яTextile Test Methods Colourfastness and Dimensional Change in Domestic Laundering of Textiles-Amendment 1: December 1997T=яxt?t‡t t|БBд=P>я˜>яGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T>яŠtAt‹t t|Бiд=P?я˜?яGemeral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T?яŠtCtŽt t|Бiд=P@я˜@яGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T@яŠtEt‘t t|Бiд=PAя˜AяGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990o Rubbing (Crocking);я~;яTextile Test Methods Textile Fabrics - Determination of Resistance to Surface Wetting (Spray Test)-ISO 4920:1981T;яpt;tƒt tущ‡яѕ“ ЋTђt Ь6тJіfБ] ЖbœHє LјYfZN њ B ю € , Л g  В Q §œHч“2о})е­-йY…1˜DД` гu‰uxlNa5Э0))DIAGRAM1аЯрЁБс>ўџ ўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ§џџџўџџџ ўџџџ ўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ§џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџRoot Entryџџџџџџџџ ћШк Х€fџџџџџџџџџџџџoџџџџ CompObjџџџџџџџџџџџџ"aўџџџ  !ўџџџ#ўџџџ%&'()*+,-./012345678ўџџџўџџџ;<=>?@ўџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ§џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ(  €џџ}liњ?Хg„Mо€[ё•аА ЊНЫ\08+ йцАща­Q ЩW9pтNFЧ§в—CZ™OaЭгO­хг=РOyј1,C SDMвбŽc`—впHш™…PŠпбЂа`—Фо$,C QDMвбŽc`—впHцkЖŸ\ВЯКЈЊЂ0(„|Ѕ €b€S€Control3†0ўRelationship 'FK_RequestedItems_LoginLogs' between 'LoginLogs' and 'RequestedItems',Е €1i€DDSLabel4864Ѕ €Є€ €SchGrid1ќ!` LoginLogs8Ѕ €Ў€€SchGrid2№<2RequestedItemsrj%J В1*Q7*Q7Ш№<ШдаШ№fŒ%86›Ї(›Їџџџ€DBTahomaFK_RequestedItems_LoginLogs!C4Жh xV4LoginLogstems№`џџџT,,,4Y#^- rFXю „eЃe‘ЯЖh rЖh rЖЪrj%J ržАxV4\  dbo LoginLogs!C4ЖЂxV4RequestedItems№`џџџT,,,4Y#J- rFXю „eЃe‘ЯЖЂ rЖЂ  rЖЪrj%J ržАxV4f  dboRequestedItems0,1,1350,2,600,5,ўџ џџџџMicrosoft Forms 2.0 FormEmbedded Objectє9ВqViewMode:2 &sch_labels_visible d n9H‡а(ActiveTableViewMode1 TableViewMode:0D5,0,28DdsStreamџџџџ$?Schema UDV Default&џџџџџџџџџџџџ9DSREF-SCHEMA-CONTENTS,џџџџ:ИSchema UDV Default Post V66џџџџџџџџџџџџA4,0,1650,1,1350,2,600,5,900 TableViewMode:12,0,284,0,1650 TableViewMode:22,0,284,0,1650 TableViewMode:32,0,284,0,1650 TableViewMode:4>4,0,284,0,1650,12,1950-11,1200(DDˆа(ActiveTableViewMode1 TableViewMode:0D5,0,284,0,1650,1,1350,2,600,5,900 TableViewMode:12,0,284,0,1650 TableViewMode:22,0,284,0,1650 TableViewMode:32,0,284,0,1650 TableViewMode:4>4,0,284,0-1650,12,1950,11,1200H BOH‹dboFK_RequestedItems_LoginLogsРР+№fOЅH B n9(DDQ4 NaМџџџџцŒџv,@Вrl >ўлцАща­Q ЩW9а9jк ХH DRIVER=SQL Server;SERVER=PALCAN.SCC.CA;UID=sa;PWD=welcome;APP=MS SQLEM - Data Tools;WSID=CGI-011859;DATABASE=eSpecs;AutoTranslate=Yes€DIAGRAM1&LoginLogsdbo$RequestedItemsdbo : Tyre designations and dimen@(`H№HА~H˜~H@€PЈzHА|H–ЊиzH'Œрє`:ˆg:f:CEhš) pŽšџџџџџ''џџџџџџ(0)џџџџџCEhš) @ŽšџџџџCEhš) pŽšџџџџџџБА|Hw3’њ№}HPр}H(EtP~H2533А|H 14879-1:200А|Hmplaupper([Scopes_Web].[dbo].[Scope].[Lang])ce proА|Hies `~H3А|Hal t(№}HДe:CEhš)ŽšџџџџџЗБЦšе.E›w3’њBЬ„w3Ы8(`H№HiГГДЦЪ025333ISO 10993-1:1997ENBiological evaluation of medical devices -- Part 1: Evaluation and testingE025333_en_cpdf.pdf9599 h@@ гЮё?„Ь рyH l@@=Яѕ?„Ь zH h@@Япђ?„Ь  zH№'L``@@{‚Ф[ЉџMžя5Б?ѕЈ@bH` Z іvЮы ^X8бVО`]‹ЛwЯїBƒа<TT TTTT T T T T TTTTTTTTTT T!TdTeTfTgThTiTjTk Tl!Tm"Tn#To$Tp%Tq&Tr'Ts(Tt)Tu*Tv+Tw,Tx-Ty.TШ/TЩ0TЪ3T4T,5T-6T.7T/8T09T1:T2;T3<T4=T5>T6?T7@T8AT9 T:BT;CT<%T=DT>ET?FT@TAGTBHTDITEJTFKTGLTHMTINThOAPAQARAiSAjTAkUAlVAnWAnXAoYApZAq[Ar\AsM||N}}AР@@@ЬАA№A№?рр@`AUU•@фpA$B…ыб? AјAЯѓМ?€@№A№?+AшAш@0AаAонн?F0AР@š™™?PР@ИA%Iв?bрAИA9Ž#@mР@$Bžчљ>† @B@˜€@рAUU@Јр@˜A33ѓ?Д`A€A9Žу?С0A0BІЅ%@е A0AЭЬ @лŒB€AЋЊ*@фˆA€A%I@я AиAOь@ў AјAЧq\@ ABЎЧ?(Р@ЈAр?7A˜AFн?EpA0A0@MAШAЧ1@}€A˜A˜@ƒ€AАAЋЊj@‹AрAгвв?AˆAˆ@Ђ@A˜Ar@Ќ@AШAb'і?МA@A@УA€A%I@ЭР@@AР?жAиAnлі?чAРAщЂ @їР@ A ? @8B@РA€A9Žу?,@A8Btб@Fр@аAа?Z0AаA@iA˜AБЛ?xAјAffF@†€AШA]t@”A B`@ŸABI’$@ЏA№A@@Н`AиAX@Ц`A`A@ЮР@PAЋЊ @е€?ˆAЧё?рР@№A@ђAшAьФ@Р@@A@@иAB@`A Р@шAьФ@ @@8BUUѕ?. р@Bё№№?@ р@Bš™љ?Y @@8BUUѕ?w A::Ј{ЬK-1ИСЭKЈ|ЬK№?(|™8K\exКйчю„ŠDЯKZZ№???0|ЬK€wЬK0}ЬK(|™8KtxКйчю„­uНKrr№?‹‹И|ЬKаЭKИ}ЬK№?(|™8KфyxКйчю„!єеKтт№?‚‚@}ЬKX K@~ЬK(|™8K|xКйчю„AqЛJzz№?00Ш}ЬKxOKШ~ЬK@(|™8K,5xКйчю„иXзK**№?<<P~ЬK hOKPЬK(|™8KT[xКйчю„uhЛKRR№?-ybK‚v_H1ьеОЇ4яиСЊ“eN7 ђФ­–hQ:# ѕоЧА™ л|ЄkT=&јсЪГœ…nW@)ћфЭЖŸˆqZC,ўчаЙЂ‹t]F/ъгМЅŽw` Z2іxЩ™^n8ˆу+О`A 2™1yЩD&ёxml&bigint&­binary&hbit&Џchar&=datetime&jdecimal&>float&"image&8int&<money&яnchar&cntext&lnumeric&чnvarchar&;real&:'smalldatetime&4smallint&z!smallmoney&b#sql_variant&sysname&#text&Нtimestamp&0tinyint&$-uniqueidentifier&Ѕvarbinary&Їvarchar`їЪЏ{`=џиУІ‹t]F3ъЭИЅŒsС%,l’zЯї 0%ЂЂцqšЈцqš2sys<C€@†B€@.E\sŠЁИЯц§+BYp‡žЕЬуњ(?Vm„›ВЩрї%<Sj˜ЏЦнє "9Pg~•ЌУкё6M€?€?€?€?€?€?€?€?@@€? €?€?€?@@€?€?€?_€?`€?’U€?Ы5I€?Z=€?=~1€?vЂ%€?ЏЦ€?шъ €?"€?Z3і€?“Wъ€?Ь{о €? в €?>ФЦ €?wшК €?А Џ €?щ0Ѓ€?"U—€?[y‹€?”€?ЭСs€?цg€?? \€?x.P€?БRD€?ъv8€?Ю €?,§€?@Pё€?ytх€?˜й€?ыМЭ€?$сС €?]Ж!€?–)Њ"€?ЯMž#€?r’$€?A–†%€?zКz&€?­:яs€?ц^уt€?ЪяГx€?Јy€?<8œz€?u\{€?Ў€„|€?чЄx}€? Щl~€?Yэ`!НЯ !НmREšЮЮ†š<4P9orмpЙApоEп†K@ A4OlˆЃНзѓ (Fa|–Жбы :Vq‹ІУољ.Ic~™ГЭш ;UpŠЄПмі*D]w“­Шуќ2Mh‚Звь!<VqЇСмі,Fa{•АЪх  5 P k … Ÿ Й г ю # = Y s Ž Ћ Ч р њ  / J d } 00BAA0€?AAMA0р@AAMI0AAASHTO0@AATCC0€?ABNT0Р@ACI0€@ADC0˜AAFNOR0€?AFS0Р@AGMA0xBAIA/NAS0@@AIAG0@@AIIM0@AIM0 A AIR FORCE0AAISC0€AAMT0€?ANS0xBANSI0BAPI0иAARINC0€@ARMY0Р@ASA0 AASCE0 @ASHRAE0‚BASME0@@ASNT0pAASQ0Р@ASSE0ZCASTM0xBAWS0AAWWA0@@BHMA0#CBSI0,BCEA0€?CECC00ACEN0pACENELEC0ƒCCGSB0@CPA0€?CPSC0@CRA0 DCSA0€?CSMA0р@DELPHI0XBDIN0€?DLA0€?DNV0Р@DOD0CDS0 AECA0 AEEMUA0€@EIA0€?EJMA0 AESDU0 @EU0@FCC0€?FMVSS0„BFORD0 AGEIA0@@GME0ЈAGMNA0ŒBGMW0AGOST0€?GPA0 BICAO0@@ICC0 @ICEA0ІCIEC0BIEEE0AIESNA04BIPC0€@ISA0@ISEA0аjEISO0 @JAA0€?JEDEC0`BJSA0@JSAE0@KSA0€?LIA0€?MPIF0@@MSS0ANACE0ANAVY0@@NCSL0@NEK0BNEMA0№ANFPA0@@NSF0Р@PFI0€?PIA0@RIA0@RTCA0€?RWMA0иASAE0`BSAI0р@SBCCI0žBSCC0@@SEMI0€?SMACNA0€?SMPTE0lBSN0(BSNV0 @SNZ0@SSPC0€?TEMA0ˆBTIA0№AUL0AULCС­„С­ЋlR)š((ЭЬL>Вд9ШшA@йEA A @`€0жE ACTV-CURR0 A ACTV-NFND0Р@ INAC-INAC0ŠB INAC-REVD0ˆA INAC-WDRNТ­ЕТ­ЙlR)š((>Вд9ШреАA@йE§Ў@ A5Tm†ŸИ2аОEEN0lCEN|FR0@@EN|FR|RU0@DFR0€AGE0€?PO0€@RU0ASP8T€?€?€?€? TtŽОzz„szю z0ˆюд=Pscc.ca0€?test.com0…E ACTV-CURR0A ACTV-NFND0@@ INAC-INAC0`B INAC-REVD0PA INAC-WDRN INAC-WDRNTIA0ШAUL00AULCTї& zz{Czј zrјд=P` Zі{Юљ^w8й\О` Zі|Ю\^Z8О`џG˜й~} е‡ НіюISO/TS 16949 7 PACK **** INCLUDES AIAG ISO/TS 16949, ISO/TS 16949 QUALITY SYSTEM ASSESSMENT CHECKLIST,APQP, PPAP, FMEA, MSA, SPC ****-Harcopy Available from Global EngineeringTіюЏ}}П} }ВVд=P1їюInformation technology Security techniques Management of information and communications technology security Part 1: Concepts and models for information and communications technology security management-First Edition; Cancels and Replaces ISO/IEC TR 1335-1:1996 and ISO/IEC TR 13335-2:1997Tїю#}}Ф} }|БVд=PTAяŠtG}”} }|Бiд=P˜BяGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TBяŠ}}—} }|БBд=P˜CяGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TCяŠ}}š} }|БBд=P˜DяGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TDяŠ} }} }|БBд=P˜EяGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TEяŠ} } } }|БBд=PФFяMethodes Pour Epreuves Textiles Methodes De Pressage-Remplace Les Methodes CAN/CGSB-4.2 No.33.1- M86, CAN/CGSB-4.2 No. 33.2-M86, CAN/CGSB-4.2 No.33.3-M86 Et CAN/CGSB- 4.2 No.33.4-M86TFяЖ} }Ѓ} }|БBд=PiGяWater Quality - Determination of Permanganate Index Second Edition; (CEN EN ISO 8467: 1995)TGя[}}І} }|Бiд=PiHяInformation Technology - Code of Practice For Information Security Management-First EditionTHя[}}Љ} }|БVд=P˜IяGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancelr and Replaces ISO/IEC Guide 25: 1990TIяŠ}}­} }|БBд=P˜JяGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TJяŠ}}А} }|БBд=PTKя;INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-10th Edition№]LяMicrofilm and Electronic Images as Documentary Evidence-Anendment 1: April 2000TLяO}}Ж} }|БVд=PŽMяLife Safety Code-Errata 03-1: 4/26/03; TIA 03-1 7/25/03; TIA 03-2 7/25/03; TIA 03-3 7/25/03; TIA 03-4 7/25/03; TIA 03-5 7/25/03TMя€}}И} }|БVд=P|NяCriteria for Planning, Development, Conduct, and Evaluation of Drills and Exercises for Emergency PreparednessTNяn}}К} }|БVд=PaOяEnvironmental management systems Requirements with guidance for use-Second EditionTOяS}}О} }|БBд=P]PяStructural Standards for Steel Antenna Towers and Antenna Supporting StructuresTPяO} }С} }|БBд=PƒQяQuality Management Systems - Fundamentals and Vocabulary-Second Edition; Supersedes ISO 9000-1:1994 and ISO 8402:1994TQяu}"}Ф} }|БBд=PTRя)ASQC Q9000 Set - ASQC Q9000, Q9001, Q9004а†ЅJ0ВVКЉ@№TSя)ASQC Q9000 Set - ASQC Q9000, Q9001, Q9004а†ЅJ0ВVКЉ@№TTя)ASQC Q9000 Set - ASQC Q9000, Q9001, Q9004јц™J0ВiКЉ@ШTUя)ASQC Q9000 Set - ASQC Q9000, Q9001, Q9004јц™J0ВiКЉ@ШTVя9Accessible design for the built environment-Third EditionЉ@№˜hяGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990ThяŠ})}} }|БVд=PpiяBoiler, Pressure Vessel, and Pressure Piping Code; Part 1, 2, and 3-Sixteenth Edition; Update No 1Tiяb}+}} }|БVд=PpjяBoiler, Pressure Vessel, and Pressure Piping Code; Part 1, 2, and 3-Sjxteenth Edition; Update No 1Tjяb}-} } }|БBд=PkяMeasurement management systemsRequirements for measurement processes and measuring equipment-ISO 10012:2003; Replaces NZS 10012.1 and AS 3912.1Tkя}/} } }|БVд=PdlяGuidance on statistical techniques for ISO 9001:2000-Second Edition; ISO/TR 10017:2003TlяV}1}} }|БVд=PTmя,INSPECTION AND TESTING OF FIRE ALARM SYSTEMS0`дDpЗDр‹†K4В^КЉ@Tnя6Guide to the expression of uncertainly in measurement.d LToя$STANDARD BUILDING CODE 1997 EDITION0 LXтщK(ущKDВпИE€ущK˜pяGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TpяŠ}6}'} }|Б^д=RTqяWheelchairs - Part 1: Determination of Static Stability-Second EditionTqяF}8},} }|Б^д=P[rяWheelchairs - Part 11: Test Dummies First Edition; (CSA CAN/CSA-Z323.4.8- 94)TrяM}:}.} }|Б^д=PmsяWheelchairs - Part 2: Determination of Dynamic Stability of Electric Wheelchairs-Second EditionTsя_}<}0} }|Б^д=P[tяWheelchairs - Part 3: Determination of Effectiveness of Brakes-Second EditionTtяM}>}2} }|Б^д=PTuя$STANDARD BUILDING CODE 1997 EDITIONpF5L0В^КЉ@P2vяISO STANDARDS COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISO 14001, 14004, 14010, 14011, 14012, DIS 14015, 14020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041. 14042, 14043, TR 14049, 14050, AND TR 14061; SEE ALSO ISO 14000 SERIES AND CDTvя$}A}:} }|Бд=PwяCountersunk Slotted Raised Head Screws (Common Head Style) - Product Grade A-Third Edition; CEN EN ISO 2010: 1994Twяq}C}>} }|Б^д=PTxя$STANDARD BUILDING CODE 1999 EDITION В^Љ@P@€LyяЇyяMedical electrical equipment Characteristics of digital X-ray imaging devices Part 1: Determination of the detective quantum efficiency-First Editionde A-Third Edition; CEN EN ISO 2010: 1994Twяq}C}>} }|Б^д=PTxя$STANDARD BUILDING CODE 1999 EDITION В^Љ@P@€LDА8™ЈxвC€џъD!‡ћD,фD ъзu!ЂNШtХXЉU­СmХa pЌXш”ќЈTЌX-а|Ч K ї i  И d  x $ Œ 8 Я{ОњІК"Ю6тJіЂq` Zиі~x}н^8№'HД—О` ZіЮэ^[8$О`џD˜йh€DRT7ц†WKƒ hFѓ€EѓbzEѓˆEѓFѓpEѓpEѓ€8цElectrical equipment for measurement, control and laboratory use - EMC requirements - Part 1: General requirementsT8цr€8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3€9цElectrical equipment for measurement, control and laboratory use - EMC requirements - Part 1: General requirementsT9цr€8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3pEЫ3€:цElectrical equipment for measurement, control and laboratory use - EMC requirements - Part 1: General requirementsT:цr€8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3pEЫ3€;цElectrical equipment for measurement, control and laboratory use - EMC requirements - Part 1: General requirementsT;цr€8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓv<цElectromagnetic compatibility (EMC) - Part 4-5: Testing and measurement techniques - Surge immunity testT<цh€ 8EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3pEЖ3v=цElectromagnetic compatibility (EMC) - Part 4-5: Testing and measurement techniques - Surge immunity testT=цh€ 8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓv>цElectromagnetic compatibility (EMC) - Part 4-5: Testing and measurement techniques - Surgf immunity testT>цh€ 8EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3pEЖ3v?цElectromagnetic compatibility (EMC) - Part 4-5: Testing and measurement techniques - Surge immunity testT?цh€8EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3pEЖ3Ђ@цIndustrial, scientific and medical (ISM) radio-frequency equipment - Electromagnetic disturbance characteristics - Limits and methods of measurementT@ц”€8E04E hF04bpE04€E04ˆE04F04pE04pE04ЂAцIndustrial, scientific and medical (ISM) radio-frequency equipment - Electromagnetic disturbance characteristics - Limits and methods of measurementTAц”€8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3pEЫ3TBц8Quality Management Systems - Requirements-Fourth Edition %TCц8Quality Management Systems - Requirements-Fourth Edition‰ЏvDцLifts (elevators), escalators and moving walks — Risk assessment and reduction methodology-First EditionTDцh€8EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3TEц8Quality Management Systems - Requirements-Fourth Edition’FцAssessment of electronic and electrical equipment related to human exposure restrictions for electromagnetic fields (0 Hz - 300 GHz)TFц„€8ELE hFLbpEL€ELˆELFLpELTGц8Quality Management Systems - Requiremenvs-Fourth Edition&F™HцRepresentation of process control engineering – Requests in P&I diagrams and data exchange between P&ID tools and PCE-CAE tools-Edition 1.0THц‹€8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3СIцCRITШRES D’ACCRЩDITATION DES ORGANISMES D’ENREGISTREMENT DES SYSTШMES QUALITЩ-Same as Guide ISO/CEI 2:1996(F); Le prщsent document, de concert avec CAN-P-10Bxx, remplace CAN-P-10ATIцГ€8EћE hFћbpEћ€FћˆEћFћpEћшџџџВJцCRITERIA FOR ACCREDITATION OF ORGANIZATIONS REGISTERING QUALITY SYSTEMS-Same as ISO/IEC Guide 62:1996; This document, together with CAN-P-1517, supersedes CAN-P-10ATJцЄ€!8EћE hFћbpEћ€EћˆEћFћpEћpEћTKц8Quality Management Systems - Requirements-Fourth EditionTLц8Quality Management Systems - Requirements-Fourth EditionTMц;Quality management systems — Requirfments-Quatriшme щditionTNц@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176nOцMedical devices Quality management systems Requirements for regulatory purposes-Second EditionTOц`€'8E`3E hF`3bpE`3€E`3ˆE`3F`3pE`3pE`3yPцStandard Practice for Obtaining Colorimetric Data from a Visual Display Unit Using Tristimulus ColorimetersTPцk€)8EX3E hFX3bpEX3€EX3ˆEX3FX3pEX3pEX3 hQцStandard Test Method for Color and Color-Difference Measurement by Tristimulus ColorimetryTQцZ€+8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3TRц8Quality Management Systems - Requirements-Fourth EditionTSц;Quality management systems — Requirements-Quatriшme щdition6GqTцRecommended Practice for the Repair and Rewinding of Motors for the Petroleum and Chemical IndustryTTцc€/8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3g{TUц;Quality management systems — Requirements-Quatriшme щdition}VцQuality Management Systems - Guidelines for Performance Improvements-Second Edition; Supersedes ISO 9004-1:1994TVцo€28EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3TWц;Quality management systems — Requirements-Quatriшme щdition‡XцInformation technology - Generic coding of moving pictures and associated audio jnformation - Part 4: Conformance testingTXцy€58EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3pEP3‡YцInformation technology - Generic coding of moving pictures and associated audio information - Part 4: Conformance testingTYцy€78EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3pEP32ZцISO STANDARDS COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISO 14001, 14004, 14010, 14011, 14012, DIS 14015, 16020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041, 14042, 14043, TR 14049, 14050, AND TR 14061; SEE ALSO ISO 14000 SERIES AND CDTZц$€98EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3pEP32[цISO STANDARDS COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISO 14001, 14004, 14010, 14011, 14012, DIS 14015, 14020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041, 14042, 14043, TR 14049, 14050, AND TR 14061; SEE ALSO ISO 14020 SERIES AND CDT[ц$€;8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF32\цISO STANDARDS COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISO 14001, 14004, 14010, 14011, 14012, DIS 14015, 14020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041, 14042, 14043, TR 14049, 14050, AND TR 14061; SEE ALSO ISO 14000 SERIES AND CDT\ц$€=8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4pEJ4‡]цInformatjon technology - Generic coding of moving pictures and associated audio information - Part 4: Conformance testingT]цy€?8E0LE hF0LbpE0L€E0LˆE0LF0LpE0Lg{T^ц8Quality Management Systems - Requirements-Fourth EditionT_ц@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176`цю`цInformation Technology - Coding of Moving Pictures and Associated Audio for Digital Storage Media at up to About 1,5 Mbjt/s - Part 3: Audio-First Edition; CEN EN ISO/IEC 11172-3 1995; AS/NZS 4230.3: 1994; Corrigendum 1: 1996nts-Fourth EditionT_ц@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176==Ь&:ˆ_Ш(_Ш(˜_Ш( _Ш(Ј_Ш(А_Ш(И_Ш(Р_Ш(Ш_Ш(а_Ш(и_Ш(р_Ш(ш_Ш(№_Ш(05:H5:И5:(6:и::H;:X;:h;:@5)H5)X5)p5)ˆ5)5)5)а5)ш5)И5) 5)(5)zФpщ•cн‰W|(ЁMљ|(дcЛgџЋ2оpШt ЬЦ  Б  Ф p о Š 6 Р l  Ф"Ю,иb˜DЮzА0м\ˆ4Д`џK˜й3EF‡)Ф:$T`цр€Cƒ hFы€EыbzEыˆEыFыpEыІaцStandard Glossary of Software Engineering Terminology-Revision and Redesignation of IEEE Std 729-1983; Corrected Edition; IEEE Computer Society DocumentTaц˜8EћE hFћbpEћ€EћˆEћFћpEћWbцStandard for Software and System Test Documentation-IEEE Computer SocietyTbцI8EыE hFыbpEы€EыˆEыFыpEы^cцStandard for Software Verification and Validation-IEEE Computer Society DocumentTcцP8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3^dцRecommended for Software Project Management Plans-IEEE Computer Society DocumentTdцP8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4шџџџЎeцResidential timber-framed construction Part 3: Cyclomic areas C2 Supplement 2: Timber framing span tablesWind classification C2 Seasoned softwoodStress Grade F7Teц  8E04E hF04bpE04€E04ˆE04F04pE04Tfц8Quality Management Systems - Requirements-Fourth EditionTgц8Quality Management Systems - Requirements-Fourth EditionЄhцQuality Standard for Steel Castings for Valves, Flanges, Fittings and Other Piping Components - Visual Method for Evaluation of Surface IrqegularitiesThц– 8E04E hF04bpE04€E04ˆE04F04pE04Tiц;Quality management systems — Requirements-Quatriшme щditionTjц8Quality Management Systems - Requirements-Fourth EditionTkц@Colorimetry — Part 4: CIE 1976 L*a*b* Colour space-First EditionlцAppliances couplers for household and similar general purposes – Part 1: General requirements-Edition 2.1; Consolidated ReprintTlц8EПE hFПbpEП€EПˆEПFПpEПamцEnvironmental management systems Requirements with guidance for use-Second EditionTmцS8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓшџџџqnцQuality management systems Guidelines for configuration management-Second Edition; ISO 10007: 2003Tnцc8ELE hFLbpEL€ELˆELFLpELpELToцInterior Flat Latex PaintpцEXIGENCES GЩNЩRALES CONCERNANT LA COMPЩTENCE DES LABORATOIRES D'ЩTALONNAGES ET D'ESSAIS-Same as ISO/CEI 17025: 2005Tpцs8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4qцEXIGENCES GЩNЩRALES CONCERNANT LA COMPЩTENCE DES LABORATOIRES D'ЩTALONNAGES ET D'ESSAIS-Same as ISO/CEI 17025: 2005Tqцs8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓ™rцEnvironmental Labels and Declarations - Self-Declared Environmental Claims (Type II Environmental Labelling)-First Edition; ISO 14021: 1999Trц‹8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3Tsц8Quality Management Systems - Requirements-Fourth Edition %Ttц8Quality Management Systems - Requirements-Fourth Edition‹6Tuц8Quality Management Systems - Requirements-Fourth EditionJ€?ƒYJ4Tvц8Quality Management Systems - Requirements-Fourth EditionTwц=Corporate governance of information technology-First EditionaxцEnvironmental management systems Requirements with guidance for use-Second EditionTxцS$8EAOE hFAObpEAO€EAOˆEAOFAOpEAOayцEnvironmental management systems Requirements with guidance for use-Second EditionTyцS&8EOE hFObpEO€EOˆEOFOpEOazцEnvironmental management systems Requirements with guidance for uqe-Second EditionTzцS(8EAOE hFAObpEAO€EAOˆEAOFAOpEAOpEAOa{цEnvironmental management systems Requirements with guidance for use-Second EditionT{цS*8EAOE hFAObpEAO€EAOˆEAOFAOpEAOpEAOa|цEnvironmental management systems Requirements with guidance for use-Second EditionT|цS,8EћE hFћbpEћ€EћˆEћFћpEћT}ц8Quality Management Systems - Qequirements-Fourth Edition~,ˆяT~ц8Quality Management Systems - Requirements-Fourth Edition…цInsulated or protected cables for power systems - Bundle assembled cores for overhead systems of rated voltage 0,6/1 kvTцw08EћE hFћbpEћ€EћˆEћFћpEћpEћ…€цInsulated or protected cables for power systems - Bundle assembled cores for overhead systems of rated voltage 0,6/1 kvT€цw28EQOE hFQObpEQO€EQOˆEQOFQOpEQOg{…цInsulated or protected cables for power systems - Bundle assembled cores for overhead systems of rated voltage 0,6/1 kvTцw48EYOE hFYObpEYO€EYOˆEYOFYOpEYO…‚цInsulated or protected cables for power systems - Bundle assembled cores for overhead systems of rated voltage 0,6/1 kvT‚цw68EYOE hFYObpEYO€EYOˆEYOFYOpEYOpEYO…ƒцInsulated or protected aables for power systems - Bundle assembled cores for overhead systems of rated voltage 0,6/1 kvTƒцw88EAOE hFAObpEAO€EAOˆEAOFAOpEAOpEAO…„цInsulated or protected cables for power systems - Bundle assembled cores for overhead systems of rated voltage 0,6/1 kvT„цw:8EAOE hFAObpEAO€EAOˆEAOFAOpEAOpEAO……цInsulated or protected cables for power systems - Bundle assembled cores for overhead systems of ratee voltage 0,6/1 kvT…цw<8EљNE hFљNbpEљN€EљNˆEљNFљNpEљNшџџџ‘†цWelding consumables - Covered electrodes, wires, rods and tubular cored electrodes for fusion welding of cast iron - ClassificationT†цƒ>8EAOE hFAObpEAO€EAOˆEAOFAOpEAOpEAO‘‡цWelding consumables - Covered electrodes, wires, rods and tubular cored electrodes for fusion welding of cast iron - ClassificationT‡цƒ@9EQOE hFQObpEQO€EQOˆEQOFQOpEQOpEQOTˆц8Quality Management Systems - Requirements-Fourth Edition‚‰цWelding consumables - General product standard for filler metals and fluxes for fusion welding of metallic materialsT‰цtC8EљNE hFљNbpEљN€EљNˆEљNFљNpEљNpEљNTŠц8Quality Management Systems - Requirements-Fourth EditionП‹цTests for Electric Cables under Fire Conditions - Circuit Integrity - Part 21: Procedures and Requirements - Cables of Rated Voltage up to and Including 0,6/1,0 kV-First EditionT‹цБF8EћE hFћbpEћ€EћˆEћFћpEћ‚ŒцWelding consumables - General product standard for filler metals and fluxes for fusion welding of metallic materialsTŒцtH8EЪLE hFЪLbpEЪL€EЪLˆEЪLFЪLpEЪLg{цЁцWelding consumables - Covered electrodes, wires, rods and tubular cored electqodes for fusion welding of cast iron - Classification (ISO 1071:2003)Œц‚ŒцWelding consumables - General product standard for filler metals and fluxes for fusion welding of metallic materialsTŒцtH8EЪLE hFЪLbpEЪL€EЪLˆEЪLFЪLpEЪLg{nal community has decided to make this standard available onЄBРl­Yƒ/лJіeŒ8Г_к†­(дOћv"ЮzХdЏ[њІEё  I ѕ Ё M Д ` п ‹ Ж b ё<ш[Г_ gПkНi ЗYЎZД`џS˜йŠ.‚IК LTц“Jƒ hFЖL€EЖLbzEЖLˆEЖLFЖLpEЖLшџџџTŽц8Quality Management Systems - Requirements-Fourth EditionTц)Process Piping-Includes Interpretation 21<  %цdцPipe Threads, General Purpose (Inch)-Revision and Redesignation of ASME/ANSI B2.1-1968TцV‚8EпLE hFпLbpEпL€EпLˆEпLFпLpEпLT‘ц&Welded and Seamless Wrought Steel Pipe``tion{@T’цStainless Steel PipeWrought Steel Pipe``tion{@“цЄ“цStandard Specification for Forged or Rolled Alloy and Stainless Steel Pipe Flanges, Forged Fittings, and Valves and Parts for High-Temperature ServiceT“ц–‚8EпLE hFпLbpEпL€EпLˆEпLFпLpEпLpEпL”цv”цStandard Specificatjon for Stainless Steel Bars and Shapes for Use in Boilers and Other Pressure VesselsT”цh‚ 8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3•цS•цBoiler, Pressure Vessel, and Pressure Piping Code-Seventeenth EditionT•цE‚ 8EћE hFћbpEћ€EћˆEћFћpEћpEћ–цl–цGeneral requirements for the competence of testing and calibration laboratories-Second editionT–ц^‚ 8EћF hFћbpEћ€EћˆEћFћpEћpEћT—ц;Quality management systems — Requirements-Quatriшme щdition˜цl˜цGeneral requirements for the competence of testing and calibration laboratories-Second editionT˜ц^‚8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4™цP™цStandard Specification for Hydrogen Thermophysical Property TablesT™цB‚8EћE hFћbpEћ€EћˆEћFћpEћpEћ šц‘šцStandard Test Methods for Measuring Resistivity and Hall Coefficient and Determining Hall Mobility in Single-Crystal SemiconductorsTšцƒ‚8EME hFMbpEM€EMˆEMFMpEMg{T›ц8Quality Management Systems - Requirements-Fourth EditionTœц8Quality Management Systems - Requirements-Fourth EditionTц3Symbols for use in the labelling of medical devices~,ˆяTžц1Electric road vehicles Vocabulary-Second EditionYі+acTŸц3Symbols for use in the labelling of medical devices  %T ц Power PipingTЁц8Quality Management Systems - Requirements-Fourth Editionџјq.TЂц8Standard Practice for Dealing With Outlying Observationsџјq.Ѓц^ЃцStandard for Software Verification and Validation-IEEE Computer Society DocumentTЃцP‚8EJNE hFJNbpEJN€EJNˆEJNFJNpEJNpEJNЄцWЄцStandard for Software and System Test Documentation-IEEE Computer SocietyTЄцI‚ 8EŒNE hFŒNbpEŒN€EŒNˆEŒNFŒNpEŒNTЅц;Information supplied by the manufacturer of medical devicesP"GІцWІцBiological evaluation of medical devices - Part 1: Evaluation and testingTІцI‚#8EZNE hFZNbpEZN€EZNˆEZNFZNpEZNЇцQЇцMedical devices - Application of risk management to medical devicesTЇцC‚%8E›NE hF›NbpE›N€E›NˆE›NF›NpE›NTЈц8Quality Management Systems - Requirements-Fourth EditionTЉц8Quality Management Systems - Requirements-Fourth EditionTЊцPower Switching EquipmentTЋцSteel Fittings-Fifth EditionTЌцSteel Pipe-Eighth EditionT­ц3Steel Flanges-Fifth Edition; Update No 1: June 2006TЎцSteel Valves-Sixth EditionЏц€ЏцSafety of machinery Safety-related parts of control systems Part 1: General principles for design-Second EditionTЏцr‚.8EвLE hFвLbpEвL€EвLˆEвLFвLpEвLTВц;Quality management systems — Requirements-Quatriшme щditionP"GTБц;Quality management systems — Requirements-Quatriшme щditionP"GTВц;Quality management systems — Requirements-Quatriшme щditionTГц;Quality management systems — Requirements-Quatriшme щditionP"GTДц;Quality management systems — Requirements-Quatriшme щdition0ƒY0LTЕц;Quality management systems — Requirements-Quatriшme щditionTЖц:Quality management systems — Requirements-Quatriшme щditionP"GTЗц;Quality management systems — Requirements-Quatriшme щditionјŸи(TИц;Quality management systems — Requirements-Quatriшme щdition0ƒY0LTЙц8Quality Management Systems - Requirements-Fourth EditionionКцlКцGeneral requirements for the competence of testing and calibration laboratories-Second editionTКц^‚:8EX3E hFX3bpEX3€EX3ˆEX3FX3pEX3Лц„ЛцGeneral requirements for the competence of testing and calibration laboratories TECHNICAL CORRIGENDUM 1-Second editionTЛцv‚<8ELE hFLbpEL€ELˆELFLpELМцoМцSystшmes de management de la qualitщ — Lignes directrices pour les plans qualitщ-Deuxiшme щditionTМцa‚>8EчLE hFчLbpEчL€EчLˆEчLFчLpEчLНцlНцProject 25 Digital Radio Over.the-Air Rekeying (OTAR) Protocol-Upgrade of TIA/EIA/TSB-102.AACATНц^‚@8E0LE hF0LbpE0L€E0LˆE0LF0LpE0LшџџџОцeОцQuality Management Systems - Requirements for Aviation, Space and Defense OrganizationsTОцW‚B8E04E hF04bpE04€E04ˆE04F04pE04ПцoПцSystшmes de management de la qualitщ — Lignes directrices pour les plans qualitщ-Deuxiшme щditionTПцa‚D8EЪNE hFЪLbpEЪL€EЪLˆEЪLFЪLpEЪLЊvЪLTРц;Quality management systems — Requirements-Quatriшme щditionСцZСцStandard For FLAME TESTS OF FLAME-RESISTANT FABRICS AND FILMS-Second EditionTСцL‚G8EЪLE hFЪLbpEЪL€EЪLˆEЪLFЪLpEЪLpEЪLТцVТцAcceptability for Electronic Assemblies-Incorporates Errata: May 1, 2005TТцH‚I8EїLE hFїLbpEїL€EїLˆEїLFїLpEїL€?TУц'Acceptability for Electronic AssembliesФцOФцRequirements and Acceptance for Cable and Wire Harness AssembliesTФцA‚L8EїLE hFїLbpEїL€EїLˆEїLFїLpEїLpEїLХц‹ХцInterim 2006 Standard Specifications for Structural Supports for Highway Signs, Luminaires and Traffic Signals-Fourth EditionTХц}‚N8E‡ME hF‡MbpE‡M€E‡MˆE‡MF‡MpE‡MЦцlЦцGraphical symbols — Test methods — Part 1: Methods for testing comprehensibility-First EditionTЦц^‚P8EЏME hFЏMbpEЏM€EЏMˆEЏMFЏMpEЏMЧцlЧцGraphical symbols — Test methods — Part 2: Method for testing perceptual quality-First EditionТ`є’ЅVє JшŽ,иiЂ@дrЁЛOэ™EёIѕЁMљЅ%УoЧsЫw&Ф m З ` ў   > ъ – B ю š F ђž Ћ[љ+зk ЖTо|иv"ЮjД`џO˜йƒ/ƒLД’1@TЧц^‚Rƒ hFЏM€EЏMbzEЏMˆEЏMFЏMpEЏMpEЏMШц`ШцEarth-moving machinery — Machine safety labels — General principles-Second EditionTШцRƒ8EЏME hFЏMbpEЏM€EЏMˆEЏMFЏMpEЏMpEЏMTЩц8Quality Management Systems - Requirements-Fourth EditionTЪц8Quality Management Systems - Requirements-Fourth EditionЊTЫц8Quality Management Systems - Requirements-Fourth EditionL TЬц8Quality Management Systems - Requirements-Fourth EditionВDTЭц)Workplace electrical safety-First EditionЮцwЮцIdentification cards Integrated circuit cards Part 9: Commands for card management-ISO/IEC 7816-9: 2004TЮцiƒ8EыE hFыbpEы€EыˆEыFыpEыTЯц/Cementitious materials compendium-Third EditionTац8Quality Management Systems - Requirements-Fourth EditionTбц+Mechanical Refrigeration Code-Tenth EditionвцPвцStandard Specification for Hydrogen Thermophysical Property TablesTвцBƒ 8E0LE hF0LbpE0L€E0LˆE0LF0LpE0LгцІгцQuality Management Systems - Aerospace - Requirements-Remains ‘Actjve’ for certification purposes. 9/1/2011 is the end of the 30-month transition periodTгц˜ƒ8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3Tдц8Quality Management Systems - Requirements-Fourth Editionђ4ецwецIdentification cards Integrated circuit cards Part 9: Commands for card management-ISO/IEC 7816-9: 2004Tецiƒ8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3жцwжцIdentification cards Integrated circuit cards Part 9: Commands for card management-ISO/IEC 7816-9: 2004Tжцiƒ8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3Tзц;Quality management systems — Requirements-Quatriшme щditionиц~ицMedical devices — Application of risk management to medical devices-Second edition; Corrected Version 10/01/2007Tицpƒ8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓйцnйцNedical devices Quality management systems Requirements for regulatory purposes-Second EditionTйц`ƒ8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓкцкцEXIGENCES GЩNЩRALES CONCERNANT LA COMPЩTENCE DES LABORATOIRES D'ЩTALONNAGES ET D'ESSAIS-Same as ISO/CEI 17025: 2005Tкцsƒ8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3лц]лцQuality Assurance Program - Category 4-Second Edition; General Instruction No"1TлцOƒ8E`3E hF`3bpE`3€E`3ˆE`3F`3pE`3мцмцEXIGENCES GЩNЩRALES CONCERNANT LA COMPЩTENCE DES LABORATOIRES D'ЩTALONNAGES ET D'ESSAIS-Same as ISO/CEI 17025: 2005Tмцsƒ8E`3E hF`3bpE`3€E`3ˆE`3F`3pE`3pE`3нцƒнцEnvironmental Management Systems - General Guidelines on Principles, Systems and Supporting Techniques-Second EditionTнцuƒ!8EЫ3E hFЫ3bpEЪ3€EЫ3ˆEЫ3FЫ3pEЫ3оцaоцEnvironmental management systems Requirements with guidance for use-Second EditionTоцSƒ#8E0LE hF0LbpE0L€E0LˆE0LF0LpE0LпцЎпцSecondary cells and batteries containing alkaline or other non-acid electrolytes Secondary lithium cells and batteries for portable applications-First EditionTпц ƒ%8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3Tрц%Pipeline SCADA Security-First EditionTсц8Quality Management Systems - Requirements-Fourth EditionтцOтцFire-resistance tests — Door and shutter assemblies-Third editionTтцAƒ)8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3уцtуцFire-Resistance Tests - Elements of Building Construction - Part 1: General Requirements-First EditionTуцfƒ+8EвLE hFвLbrEвL€EвLˆEвLFвLpEвLфц_фцNatural Airflow Ventilators for Buildings-Third Edition; General Instruction No 1TфцQƒ-8EвLE hFвLbpEвL€EвLˆEвLFвLpEвLpEвLхц]хцRigid cellular plastics — Determination of compression properties-Fifth EditionTхцOƒ/8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3ццeццPlastics - Determination of Flexural Properties-Fourth Edition; Amenfment 1: 02/15/2004TццWƒ18EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3Tчц8Quality Management Systems - Requirements-Fourth EditionTшц;Quality management systems — Requirements-Quatriшme щditionTщц;Quality management systems — Requirements-Quatriшme щditionъцOъцRequirements and Acceptance for Cable and Wire Harness AssembliesTъцAƒ68EчLE hFчLbpEчL€EчLˆEчLFчLpEчLыцˆыцPlastics - Determination of Tensile Properties - Part 2: Test Conditions for Moulding and Extrusion Plastics-First EditionTыцzƒ88EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3Tьц8Compressed Air - Part 1: Contaminants and Purity ClassesэцСэцPlastics - Determination of Tensile Properties - Part 3: Test Conditions for Films and Sheets-First Edition; Technical Corrigendum 1:06-15-1998; Tfchnical Corrigendum 2:04-15-2001TэцГƒ;8ELE hFLbpEL€ELˆELFLpELTюц8Compressed Air - Part 1: Contaminants and Purity Classesf%Tяц8Compressed Air - Part 1: Contaminants and Purity ClassesT№ц8Compressed Air - Part 1: Contaminants and Purity ClassesTёц8Compressed Air - Part 1: Contaminants and Purity ClassesђцЕђцIron Ores - Determination of Zinc Content - Flame Atomic Absorption Spectrometric Method-First Edition; Together with ISO 13311, It Cancels and Replaces ISO 8753: 1987TђцЇƒA8EїLE hFїLbpEїL€EїLˆEїLFїLpEїLpEїLTѓц8Compressed Air - Part 1: Contaminants and Purity Classesf%Tєц8Compressed Air - Part 1: Contaminants and Purity Classesf%Tѕц8Compressed Air - Part 1: Contaminants and Purity ClassesTіц8Compressed Air - Parv 1: Contaminants and Purity ClassesTїцUnleaded Automotive GasolineTјц Automotive (On-road) Diesel FuelљцЊљцNut, Self-Locking, Plate - Two Lug, Floating, Variable Counterbore, Replaceable Nut Element 125KSI Ftu, 450 Degrees F and 800 Degrees F-Revision 1; FSC 5310TљцœƒI8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3Tњц;Design of Stfel Transmission Pole Structures Second EditionTћц;Design of Steel Transmission Pole Structures Second EditionTќц;Design of Steel Transmission Pole Structures Second Edition %T§ц;Design of Steel Transmission Pole Structures Second Edition ( A@Рњ+И~№Я Ьл‡3п‹с+зƒ/л‡вpШt _§Љ!ПpКf­KюŒ-ЫWѕІD№œюŒ+Щ F ф c  Є B С _ ё   Џ[ф‚ ЉUЏM§›GѓŸ(ЦrЪv"Т`џO˜йK%„PЉ $Tўц;Design of Steel Transmission Pole Structures Second EditionЛџцHousehold and similar electrical appliances – Safety – Part 2-29: Particular requirements for battery chargers-Edition 4.1; Edition 4:2002 Consolidated with Amendment 1:2004Tџц­„8EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3Tч8Quality Management Systems - Requirements-Fourth EditionTч8Quality Management Systems - Requirements-Fourth EditionOчSTANDARD FOR SPACE HEATERS FOR USE WITH SOLID FUELS-Third EditionTчA„8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3шџџџTч!Underground Systems-Third EditionЧДwth‰ІчQuality Management Systems - Aerospace - Requirements-Remains ‘Active’ for certification purposes. 9/1/2011 is the end of the 30-month transitimn periodTч˜„8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3иcML~чStandard Specifications for Structural Supports for Highway Signs, Luminaires and Traffic Signals-Fourth EditionTчp„ 8E04E hF04bpE04€E04ˆE04F04pE04‹чInterim 2002 Standard Specifications for Structural Supports for Highway Signs, Luminaires and Traffic Signals-Fourth EditionTч}„ 8E04E hF04bpE04€E04ˆE04F14pE04‹чInterim 2003 Standard Specifications for Structural Supports for Highway Signs, Luminaires and Traffic Signals-Fourth EditionTч}„8EX3E hFX3bpEX3€EX3ˆEX3FX3pEX3Tч-Part V Paints – Primers, General RequirementsT ч-Part V Paints – Primers, General RequirementsT ч;Quality management systems — Requirements-Quatriшme щditionT ч8Quamity Management Systems - Requirements-Fourth Edition чFoodstuffs - Determination of vitamin D by high performance liquid chromatography - Measurement of cholecalciferol (D3) and ergocalciferol (D2)T ч„8E`3E hF`3bpE`3€E`3ˆE`3F`3pE`3T чSteel Pipe-Eighth EditionИ Я ц §  Tч8Quality Management Systems - Requirements-Fourth EditionTч;Quality management sysuems — Requirements-Quatriшme щditionTч;Quality management systems — Requirements-Quatriшme щditionTч;Quality management systems — Requirements-Quatriшme щditionlчGeneral requirements for the competence of testing and calibration laboratories-Second editionTч^„8EX3E hFX3bpEX3€EX3ˆEX3FX3pEX3„чGeneral requirements for the competence of testing and calibration laboratories TECHNICAL CORRIGENDUM 1-Second editionTчv„8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3Tч;Quality management systems — Requirements-Quatriшme щditionTч8Quality Management Systems - Requirements-Fourth EditionionnчRoad vehicles - Securing of cargo in delivery vans - Requirements and test methods-First EditionTч`„!8EгLE hFгLbpEгL€EгLˆEгLFгLpEгL_чStandard Test Method for Glazimg and Glazing Systems Subject to Airblast LoadingsTчQ„#8EПE hFПbpEП€EПˆEПFПpEПTч?Standard Test Method for Security Glazing Materials And SystemsTч?Standard Test Method for Security Glazing Materials And SystemssчGlass in building - Security glazing - Testing and classification of resistance against bullet attackTчe„'8Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3Tч;Quality management systems — Requirements-Quatriшme щditionTч;Quality management systems — Requirements-Quatriшme щditionˆяlчGeneral requirements for the competence of testing and calibration laboratories-Second editionTч^„+8EвLE hFвLbpEвL€EвLˆEвLFвLpEвLpEвLTч;Quality management systems — Requirements-Quatriшme щditionaЙэCleanrooms and associated controlled environments Part 5: Operauions-First EditionTЙэS„.8EпLE hFпLbpEпL€EпLˆEпLFпLpEпL`EпLiКэCleanrooms and associated controlled environments - Part 3: Test methods (ISO 14644-3:2005)TКэ[„08EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3шџџџnЛэCranes and Lifting Appliances - Technical Characteristics and Acceptance Documents First EditionTЛэ`„28E0LE hF0LbpE0L€E0LˆE0LF0LpE0LxМэCranes and Related Equipment - Accuracy Requirements for Measuring Parameters During Testing First EditionTМэj„48E0LE hF0LbpE0L€E0LˆE0LF0LpE0LpE0LPНэCranes - Measurement of Velocity and Time Parameters-First EditionTНэB„68E0LE hF0LbpE0L€E0LˆE0LF0LpE0LpE0LTОэ;Quality management systems — Requirements-Quatriшme щditionoПэSpecification for Fusion Welding for Aerospace Applications-Second Printing- Incorporating ErrataTПэa„98EЪLE hFЪLbpEЪL€EЪLˆEЪLFЪLpEЪL“РэStandard Test Method for Measurement of Surface Roughness of Abrasive Blast Cleaned Metal Surfaces Using a Portable Stylus InstrumentTРэ…„;8E0LE hF0LbpE0L€E0LˆE0LF0LpE0LTСэ8Quality Management Systems - Requirements-Fourth EditionTТэ8Quality Management Systems - Requirements-Fourth Edition„УэProtective clothing - Mechanical properties - Determination of resistance to cutting by sharp objects (ISO 13997:1999)TУэv„?8E0LE hF0LbpE0L€E0LˆE0LF0LpE0LpE0L|ФэClinical investigation of medical devices for human subjects - Part 1: General requirements (ISO 14155-1:2003)TФэn„A8ELE hFLbpEL€ELˆELFLpEL„ХэClinical investigation of medical devices for human subjects - Part 2: Clinicam investigation plans (ISO 14155-2:2003)TХэv„C8E0LE hF0LbpE0L€E0LˆE0LF0LpE0LpE0LTЦэ;Quality management systems — Requirements-Quatriшme щdition VЧэStandard for Electrical Safety in the Workplace-Effective Date: 9/5/2008TЧэH„F8EыE hFыbpEы€EыˆEыFыpEыpEыaШэEnvironmental management systems Requirements with guidance for use-Second EditionTШэS„H8Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3TЩэ0Safety of machine tools - Hydraulic press brakesTЪэ;Quality management systems — Requirements-Quatriшme щditionTЫэ8Quality Management Systems - Requirements-Fourth EditionВTЬэ!Testing Methods for Woven Fabrics NF3ІY'иЭэ™ЭэGeometrical product specification (GPS) - Geometrical tolerancing - Positional tolerancing (ISO 5458:1998); German version EN ISO 5458:1998 щditionTЫэ8Quality Management Systems - Requirements-Fourth EditionВTЬэ!Testing Methods for Woven Fabrics NF3ІY'и˜>њ2 ,З+№?№?р>њ2№?аS(№?Œ*ж‚.кy%Я{'ЃOгћЇSџlЉUБ]х‘#ЯfБ] IѕЁ.к†2г   Н i  ‘ = б } ) е  - й<ш”@ь˜ Й.к\bКkУoД`џN˜й!Q…RЦбДTЭэ‹„Nƒ hF0L€E0LbzE0LˆE0LF0LpE0LшџџџЙЮэGeometrical Product Specifications (GPS) - Geometrical tolerancing - Tolerances of form, orientation, location and run-out (ISO 1101:2004); German version EN ISO 1101:2005TЮэЋ…8EыE hFыbpEы€EыˆEыFыpEы˜ЯэGeometrical Product Specifications (GPS) - Geometrical tolerancing - Tolerances of form, orientation, location and run-out (ISO 1101:2004)TЯэŠ…8EыE hFыbpEы€EыˆEыFыpEыpEыTаэ8Quality Management Systems - Requirements-Fourth Edition %tбэSTEEL, SHEET, COLD ROLLED, LOW CARBON ***TO BE USED WITH FORD WSS-M99P1111-A***-Shown on WSD-M1A333-A1Tбэf…8E0LE hF0LbpE0L€E0LˆE0LF0LpE0LpE0L_вэStandard Guidelines for the Structural Aqplications of Steel Cables for BuildingsTвэQ…8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓg{Tгэ8Quality Management Systems - Requirements-Fourth Edition %Tдэ8Quality Management Systems - Requirements-Fourth Edition %Tеэ8Quality Management Systems - Requirements-Fourth EditionTжэ8Quality Management Systems - Requirements-Fourth Edition?fзэFire-resistance tests Elements of building construction Glazed elements-Second EditionTзэX…8EZ3E hFZ3bpEZ3€EZ3ˆEZ3FZ3pEZ3Tиэ6Testing methods for water absorbency of textiles-JTETCTйэ/Guide for Application of Shunt Power Capacitors``Mќ{@Tкэ1Guide for the Protection of Shunt Capacitor Banks`{@Tлэ@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176Tмэ@ISO 9001 For Small Buqiness - What To Do - Advice From ISO/TC176Tнэ;Quality management systems — Requirements-Quatriшme щdition–оэMedical devices - Symbols to be used with medical device labels, labelling and information to be supplied - Part 1: General requirementsTоэˆ…8EПE hFПbpEП€EПˆEПFПpEПpEПTпэ6Electric Irons-Third Edition; General Instruction No 1№Ї!tрэRecommended Practice for Sizing and Selection of Elecuric Submersible Pump Installations-Third EditionTрэf…8EИ3E hFИ3bpEИ3€EИ3ˆEИ3FИ3pEИ3Г aсэEnvironmental management systems Requirements with guidance for use-Second EditionTсэS…8Eb3E hFb3bpEb3€Eb3ˆEb3Fb3pEb3Tтэ.(R) Classification System for Rubber Materials€? ŠУC)Г‚?wуэClinical Investigation of Medical Devices for Human Subjects - Part 1: General Requirements-First EditionTуэi…8EZ3E hFZ3bpEZ3€EZ3ˆEZ3FZ3pEZ3fфэGuidelines for Quality and/or Environmental Management Systems Auditing-Premiшre щditionTфэX… 8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓTхэQuality Management Systems - Fundamentals and Vocabulary-Third EditionTхэF…"8E0LE hF0LbpE0L€E0LˆE0LF0LpE0LжцэGuidelines for Quality and/or Environmental Management Qystems Auditing-First Edition; Replaces ISO 10011-1:1990, ISO 10011-2:1991, ISO 10011-3:1991, ISO 14010:1996, ISO 14011:1996, and ISO 14012:1996TцэШ…$8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓTчэRestricted Chemical SubstancesqшэRound Wire, Concentric Lay, Overhead Electrical Conductors-Second Edition; General Instruction No 1Tшэc…'8E0LE hF0LbpE0L€E0LˆE0LF0LpE0LpE0LiщэAluminum Alloy 1350 Round Wire, All Tempers, for Electrical Purposes-Amendment 1-3: May 1991Tщэ\…)8EПE hFПbpEП€EПˆEПFПpEПTъэ3Concentric - Lay Aluminum Stranded Conductors (ASC)eыэAluminum Round Wires for Use in Overhead Electrical Conductors-General Instruction No 1TыэW…,8EЖLE hFЖLbpEЖL€EЖLˆEЖLFЖLpEЖLTьэ8Quality Management Systems - Requirements-Fourth EditionTээ;Quality management systems — Requirements-Quatriшme щditionD aюэEnvironmental management systems Requirements with guidance for use-Second EditionTюэS…08EФ3E hFФ3bpEФ3€EФ3ˆEФ3FФ3pEФ3Tяэ/Magnetic Particle Acceptance Criteria for PartsT№э/Magnetic Particle Acceptance Criteria for PartsTёэ;Quality management systems — Requirements-Quatriшme щditionTђэ;Quality management systems — Requirements-Quatriшme щditionTѓэ;Quality management systems — Requirements-Quatriшme щditionyєэGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005Tєэk…78E0LE hF0LbpE0L€E0LˆE0LF0LpE0LpE0LНѕэSystшmes de management environnemental Lignes directrices gщnщrales concernant les principes, les systшmes et les techniques de mise en œuvre-Deuxieme Edition; ISO-14004:2004TѕэЏ…98EПE hFПbpEП€EПˆEПFПpEПpEПaіэEnvironmental management systems Requirements with guidance for use-Second EditionTіэS…;8Eb3E hFb3bpEb3€Eb3ˆEb3Fb3pEb3kїэAnaesthesia and Respiratory Care Alarm Signals - Part 2: Auditory Alarm Signals First EditionTїэ]…=8E0LE hF0LbpE0LE0LˆE0LF0LpE0LpE0LSјэGraphical symbols for use on equipment-DATABASE SNAPSHOTS: 02/06/2009TјэE…?8E0LE hF0LbpE0L€E0LˆE0LF0LpE0LpE0LfљэFire-resistance tests Elements of building construction Glazed elements-Second EditionTљэX…A8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓІњэFire-Resistance Tests - Elements of Building Construction - Part 8: Specific Requirements for Non-Loadbearing Verticam Separating Elements-First EditionTњэ˜…C8E04E hF04bpE04€E04ˆE04F04pE04“ћэFire-Resistance Tests - Elements of Building Construction - Part 3: Commentary on Test Method and Test Data Application-First EditionTћэ……E8EЪLE hFЪLbpEЪL€EЪLˆEЪLFЪLpEЪLlќэGeneral requirements for the competence of testing and calibration laboratories-Second editionTќэ^…G8EИ3E hFИ3bpEЙ3€EИ3ˆEИ3FИ3pEИ3Ё§эStandard Specification for Rigid Poly(Vinyl Chloride) (PVC) and Related PVC and Chlorinated Poly(Vinyl Chloride) (CPVC) Building Products CompoundsT§э“…I8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3Tўэ8Quality Management Systems - Requirements-Fourth EditionTџэ8Quality Management Systems - Requirements-Fourth Editionю‰юInformation and documentation Records management processes Metadata for records Part 1: Principles-Same as ISO 23081-1:2006 hFP3bpEP3€EP3ˆEP3FP3pEP3Tўэ8Quality Management Systems - Requirements-Fourth EditionTџэ8Quality Management Systems - Requirements-Fourth Editiont№д#8Ы%x№д#y№д#PЫ%}№д#~№д#ШfОЩ] v"|(ТnЧ\ЇS–BЩu!Эy%бpШtЛg§Љ8фК f  О X   9 х „ 0 М h  ~*ж‚.к†2Ьx$а|(Щu­YСmД`џM˜йP$†Tі@Tю{…Mƒ hFпL€EпLbzEпLˆEпLFпLpEпLpEпLюInformation and documentation - Records management processes - Metadata for records - Part 2: Conceptual and implementation issuesTю‚†8EыE hFыbpEы€EыˆEыFыpEыOюInformation and documentation - Work process analysis for recordsTюA†8EыE hFыbpEы€EыˆEыFыpEыpEыTю8Quality Management Systems - Requirements-Fourth EditionTю>Information and documentation — WARC file format-First EditionѓTю>Information and documentation — WARC file format-First EditionlюGeneral requirements for the competence of testing and calibration laboratories-Second editionTю^†8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3pEP3fюStandard Test Method for Breaking Strength and Elongation of Textile Fabrics (Grab Test)TюX† 8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4œюStandard Test Method for Tearing Strength of Fabrics by the Tongue (Single Rip) Procedure (Constant-Rate-of-Extension Tensile Testing Machine)TюŽ† 8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4pEJ4s юStandard Test Method for Abrasion Resistance of Textile Fabrics (Rotary Platform- Double-Head Method)T юe†8E№LE hF№LbpE№L€E№LˆE№LF№LpE№LZ юStandard Test Method for Protective Clothing Material Resistance to PunctureT юL†8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4pEJ4y юCleanrooms and Associated Controlled Environments - Part 4: Design, Construction and Start-Up-First EditionT юk†8E04E hF04bpE04€E04ˆE04F04pE04y юCleanrooms and!Associated Controlled Environments - Part 4: Design, Construction and Start-Up-First EditionT юk†8E№LE hF№LbpE№L€E№LˆE№LF№LpE№LpE№Ly юCleanrooms and Associated Controlled Environments - Part 4: Design, Construction and Start-Up-First EditionT юk†8E04E hF04bpE04€E04ˆE04F04pE04pE04yюCleanrooms and Associated Controlled Environments - Part 4: Design, Construction and Start-Up-First EditionTюk†8E№LE hF№LbpE№L€E№LˆE№LF№LpE№LpE№LTю@Systems and software engineering - Software life cycle processeslюInformation Technology - Guide for ISO/IEC 12207 (Software Life Cycle Processes)-First EditionTю^†8EыE hFыbpEы€EыˆEыFыpEыpEыTю8Quality Management Systems - Requirements-Fourth EditionTю8Quality Management Systems - Requirements-Fourth EditionTю"Plastic Pipe and Building ProductsƒюEnvironmental Management Systems - General Guidelines on Principles, Systems and Supporting Techniques-Second EditionTюu† 8EыE hFыbpEы€EыˆEыFыpEыpEыƒюEnvironmental Management Systems - General Guidelines on Principles, Systems and Supporting Techniques-Second EditionTюu†"8EыE hFыbpEы€EыˆEыFыpEыpEыTю>Systems and software engineering - System life cycle processes{юRubber- or Plastics-Coated Fabrics - Determination of Tensile Strength and Elongation at Break-Second EditionTюm†%8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4^юStandard Test Method for Measuring Compressive Properties of Thermal InsulationsTюP†'8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4pEJ4aюEnvironmental management systems Requirements with guidance for use-Second EditionTюS†)8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4pEJ4gюMedical laboratories Particular requirements for quality and competence-Deuxiшme щditionTюY†+8EыE hFыbpEы€EыˆEыFыpEыTю;Quality management systems — Requirements-Quatriшme щditionlюGeneral requirements for the competence of testing and calibration laboratories-Qecond editionTю^†.8EыE hFыbpEы€EыˆEыFыpEыpEыбюGreenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhancements-First EditionTюУ†08EђLE hFђLbpEђL€EђLˆEђLFђLpEђLpEђLŽюMedical electrical equipment – Medical electron accelerators – Guidelines for functional performance characueristics-Edition 2.0Tю€†28EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4юMedical electrical equipment – Medical electron accelerators – Functional performance characteristics-Edition 2.0Tюq†48EИ3E hFИ3bpEИ3€EИ3ˆEИ3FИ3pEИ3T ю;Quality management systems — Requirements-Quatriшme щditionT!ю;Quality management systems — Requirements-Quatriшme щditionT"ю?Design Guide for High-Speed Controlled Impedance Circuit Boardsb#юStandard of Common Requirements for High Voltage Power Switchgear Rated Above 1000 VT#юT†98EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4T$юSize designation of clothes - Part 2: Primary and secondary dimensionsT$юF†;8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4pEJ4%юSafety of Machinery - Permanent Means of Access to Machinery - Part 2: Working Platforms and!Walkways-First EditionT%юs†=8EZ3E hFZ3bpEZ3€EZ3ˆEZ3FZ3pEZ3x&юSafety of machinery - Permanent means of access to machinery - Part 3: Stairs, stepladders and guard-railsT&юj†?8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3†'юInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)T'юx†A8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3q(юInformation technology - Security techniques - Code of practice for information security managementT(юc†C8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3pEP3q)юInformation technology - Security techniques - Code of practice for information security managementT)юc†E8EZ3E hFZ3bpEZ3€EZ3ˆEZ3FZ3pEZ3pEZ3†*юInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)T*юx†G8EZ3E hFZ3bpEZ3€EZ3ˆEZ3FZ3pEZ3pEZ3T+ю;Quality management systems — Requirements-Quatriшme щditionT,ю8Quality Management Systems - Requirements-Fourth Edition-юІ-юSmall Craft - Stability and Buoyancy Assessment and Categorization - Part 1: Non-Sailing Boats of Hull Length Greater than or Equal to 6 m-First EditionT-ю˜†K8EћE hFћbpEћ€EћˆEћFћpEћ;Quality management systems — Requirements-Quatriшme щditionT,ю8Quality Management Systems - Requirements-Fourth Editionxv (m9ЇЇш№6г4`ЇБ>BЇШО xm94m9`m9№m9ˆm9ша*Шt šFеМ6тj•Aэ™7у;чh†2a ЁMљ’>н‰+з\Д 1 н Z  В ^ ž J і } ) А\уТhЁMБ]їЃ7у;ч˜DД`џL˜й>8‡Wc$T‰ѕ8Quality Management Systems - Requirements-Fourth EditionйjH*ƒY0LxŠѕRecords Management Part 2: Guidelines-ISO 15489.2: 2002; Supersedes in Part AS 4390.1 Thru AS 4390.6: 1996TŠѕj‡8EњLE hFњLbpEњL€EњLˆEњLFњLpEњLg{T‹ѕRegular Sulphur Diesel FuelBЎB.BИA†BTŒѕ Automotive (On-road) Diesel Fuel m@|Pтв=LH0LMќPтв=Tѕ8Quality Management Systems - Requirements-Fourth EditionD cŽѕRotating Electrical Machines - Part 9: Noise Limits-Edition 4.1; Consolidated ReprintTŽѕU‡8Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3g{OѕProcedure for Certification of Factory-Built Houses-Fifth EditionTѕA‡8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3ˆѕTechnical product documentauion Document management-First Edition; Replaces ISO 11442-1 thru ISO 11442-5 and ISO/TR 10623Tѕz‡ 8EX3E hFX3bpEX3€EX3ˆEX3FX3pEX3T‘ѕ8Quality Management Systems - Requirements-Fourth Edition’ѕGuide de l’utilisateur des palettiers en acier/Norme sur la conception et la construction des palettiers en acier-Premiшre Edition; mise р jourT’ѕ‡ 8EыE hFыbpEы€EыˆEыFыpEыWY§Iron and steel - Requirements on hot dip zinc coating of steel componentsTY§I‡8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3`EP3TZ§;Quality management systems — Requirements-Quatriшme щditionŠ[§Hydraulic fluid power — Filters — Multi-pass method for evaluating filtration performance of a filter element-Second EditionT[§|‡8EЖLE hFЖLbpEЖL€EЖLˆEЖLFЖLpEЖLŠ\§Hydraulic fluid power — Filteqs — Multi-pass method for evaluating filtration performance of a filter element-Second EditionT\§|‡8EыE hFыbpEы€EыˆEыFыpEыpEыT]§;Quality management systems — Requirements-Quatriшme щditionT^§8Quality Management Systems - Requirements-Fourth Editionionv_§Guide for Maintenance, Operation, and Safety of Industrial and Commercial Power Systems-IEEE Yellow BookT_§h‡8EПE hFПbpEП€EПˆEПFПpEП^`§Dependability management Part 1: Dependability management systems-Second EditionT`§P‡8EыE hFыbpEы€EыˆEыFыpEыЁa§Accuracy (Trueness and Precision) of Measurement Methods and Results - Part 1: General Principles and Definitions-First Edition; Corrigendum 1-1998Ta§“‡8E04E hF04bpE04€E04ˆE04F04pE04b§Accuracy (trueness and precision) of measurement methods and results - Part 1: General principles and definitionsTb§q‡8EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4Ёc§Accuracy (Trueness and Precision) of Measurement Methods and Results - Part 1: General Principles and Definitions-First Edition; Corrigendum 1-1998Tc§“‡ 8E04E hF04bpE04€E04ˆE04F04pE04pE04d§Accuracy (trueness and precision) of measurement methods and results - Part 1: General principmes and definitionsTd§q‡"8E0LE hF0LbpE0L€E0LˆE0LF0LpE0LŠe§Hydraulic fluid power — Filters — Multi-pass method for evaluating filtration performance of a filter element-Second EditionTe§|‡$8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3€?8Tf§8Quality Management Systems - Requirements-Fourth EditionTg§8Quality Management Systems - Requirements-Fourth EditionTh§;Quality management systems — Requirements-Quatriшme щditionei§Biological Evaluation of Medical Devices - Part 1: Evaluation and Testing-Third EditionTi§W‡)8EФ3E hFФ3bpEФ3€EФ3ˆEФ3FФ3pEФ3g{Tj§8Quality Management Systems - Requirements-Fourth Edition %Tk§;Quality management systems — Requirements-Quatriшme щdition %jl§Biological evaluation of medical devices - Part 1: Evaluation and testing (ISO 11993-1:2003)Tl§\‡-8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3ym§GENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005Tm§k‡/8EгLE hFгLbpEгL€EгLˆEгLFгLpEгL•n§Geometrical Product Specifications (GPS) Geometrical tolerancing Tolerances of form, orientation, location and run-out-Second EditionTn§‡‡18Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3шџџџ‡o§Technical drawings Indication of dimensions and tolerances Part 1: General principles-First Edition; Supersedes ISO 129To§y‡38EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3—p§ISO System of Limits and Fits - Part 1: Bases of Tolerances, Deviations and Fits-First Edition; CEN EN 20286-1: 1993; NZS/ISO 286.1: 1988Tp§‰‡58EФ3E hFФ3bpEФ3€EФ3ˆEФ3FФ3pEФ3Мq§ISO System of Limits amd Fits - Part 2: Tables of Standard Tolerance Grades and Limit Deviations for Holes and Shafts-First Edition; CEN EN 20286-2: 1993; NZS/ISO 286.2: 1988Tq§Ў‡78Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3pEq3‚r§ISO system of limits and fits Part 2: Tables of standard tolerance grades and limit deviations for holes and shaftsTr§t‡98EПE hFПbpEП€EПˆEПFПpEПƒs§Basic Environmental Testing Procedures - Part 2:!Tests. Test Fdb: Random Vibration Wide Band - Reproducibility MediumTs§u‡;8EФ3E hFФ3bpEФ3€EФ3ˆEФ3FФ3pEФ3pEФ3t§EXIGENCES GЩNЩRALES CONCERNANT LA COMPЩTENCE DES LABORATOIRES D'ЩTALONNAGES ET D'ESSAIS-Same as ISO/CEI 17025: 2005Tt§s‡=8EПE hFПbpEП€EПˆEПFПpEП 'u§EXIGENCES GЩNЩRALES CONCERNANT LA COMPЩTENCE DES LABORATOIRES D'ЩTALONNAGES ET D'ESSAIS-Same as ISO/CEI 17025: 2005Tu§s‡?8Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3шџџџTv§8Manual for Thermographic Analysis of Building Enclosuresqw§Calculation of Heater-tube Thickness in Petroleum Refineries-Sixth Edition; ISO 13704:2007 AdoptionTw§c‡B8EP3E hFP3bpEP3€EP3ˆEP3FP3pEP3Д@4kx§Information and documentation - Records management - Part 2: Guidelines (ISO/TR 15489-2:2001)Tx§]‡D8EыE hFыbpEы€EыˆEыFыpEыTy§8Bearing Installation and Retention by Swaging or StakingTz§1Dimensional Tolerances for Aluminum Mill ProductsZ{§Earth-moving machinery — Safety — Part 1: General requirements-First EditionT{§L‡H8Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3g{|§f|§Earth-moving machinery — Safety — Part 4: Requirements for backhoe loaders-First EditionT|§X‡J8EX3E hFX3bpEX3€EX3ˆEX3FX3pEX3s{§Z{§Earth-moving machinery — Safety — Part 1: General requirements-First EditionT{§L‡H8Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3g{xv (` 7ЇЇ@а4Пг@ џP ШО ф~ТnЦ[–Bюm˜DСmы—뇹œС,и_ ЁMљЅ@ь˜D№f“ ? ž J Ы w ж ‚ $ а Z  В^д€іЂNїЃВ^ж‚3п|(д€,Д`џE˜йkˆ7d‰R#T)š?Standard for Preparing an Electronic Components Management PlanDT*šHeat Absorbing Glass—G0рјC hДёCXІёCtВіДёC,Гі‡™GашјCT+š3Insulating Glass Units-Amendment No 1: January 2001,Гі‡™GашјC,šInformation technology - Security techniques - Information security management systems - Requirements-First EditionT,šsˆˆw"ˆ ˆ|Бсд=P-šInformation technology - Security techniques - Information security management systems - Requirements-First EditionT-šsˆˆy"ˆ ˆ|Бсд=P.šInternal Combustion Engines - Determination and Method for the Measurement of Engine Power - General RequirementsT.šqˆˆ}"ˆ ˆ|Бсд=P/šInternal Combustion Engimes - Determination and Method for the Measurement of Engine Power - General RequirementsT/šqˆ ˆ"ˆ ˆ|Бсд=P^0šQuality Management - Guidelines for Quality Plans-First Edition; ISO 10005: 1995T0šPˆ ˆƒ"ˆ ˆ|Бсд=P†1šInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)T1šxˆ ˆ‡"ˆ ˆ|Бід=P2šInformation technology - Security techniques - Information security management systems - Requirements-First EditionT2šsˆˆ‰"ˆ ˆ|Бід=P~3šInformation technology Security techniques Code of practice for information security management-Second EditionT3špˆˆ‹"ˆ ˆ|Бсд=PT4šFlat, Clear Eloat GlassC ЭCЂЭCВсЉ@XXP`УC4ВсqFšQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TFšcˆˆ­"ˆ ˆ|Бід=PaGšEnvironmental management systems Requirements with guidance for use-Second EditionTGšSˆˆЏ"ˆ ˆ|Бід=P)HšStructural Standard for Antenna Supporting Structures and Antennas-EEFECTIVE JANUARY 1, 2006; Includes County Listing 07/20/2005 after TIA-222-G standard - Please contact Global Engineering Documents (1-800-447-3352 ext.4960) for a electronic version of the 07/20/2005 County ListingTHšˆˆГ"ˆ ˆ|Бсд=P)IšStructural Standard for Antenna Supporting Structures and Antennas-EFFECTIVE JANUARY 1, 2006; Includes County Listing 07/20/2005 after TIA-222-G standard - Please contact Global Engineering Documents!(1-800-447-3352 ext.4960) for a electronic version of the 07/20/2005 County ListingTIšˆˆЕ"ˆ ˆ|Бсд=PКJšWelding consumables Solid wires, solid wire-flux and tubular cored electrode-flux combinations for submerged arc welding of non alloy and fine grain steels ClassificationTJšЌˆˆЙ"ˆ ˆ|Бсд=PwKšSoftware engineering Guidelines for the application of ISO 9001:2000 to computer software-First Edition;TKšiˆˆН"ˆ ˆ|Бід=PlLšGeneral requirements for the competence of testing and calibration laboratories-Second editionTLš^ˆ ˆУ"ˆ ˆ|Бід=PTMšQuality Management Systems - Fundamentals and Vocabulary-Third EditionTMšFˆ"ˆЩ"ˆ ˆ|Бсд=PTNšQuality Management Systems - Fundamentals and Vocabulary-Third EditionTNšFˆ$ˆЫ"ˆ ˆ|Бсд=PmOšQuality Management Systems - Aerospace - Requirements-Technically Equivalent to AECMA prEN 9100TOš_ˆ&ˆЭ"ˆ ˆ|Бсд=PPPšMathematical Definition of Dimensioning and Tolerancing PrinciplesTPšBˆ(ˆЯ"ˆ ˆ|Бсд=PPQšMathematical Definition of Dimensioning and Tolerancing PrinciplesTQšBˆ*ˆб"ˆ ˆ|Бсд=PlRšGeneral requirements for the competence of testing and calibration laboratories-Second editionTRš^ˆ,ˆж"ˆ ˆ|Бід=PSšHot Dip Galvanized Coatings on Fabricated Iron and Steel Articles - Specifications and Test Method-Second EditionTSšqˆ.ˆн"ˆ ˆ|Бсд=PTšHot Dip Galvanized Coatings on Fabricated Iron and Steel Articles - Specifications and Test Method-Second EditionTTšqˆ0ˆп"ˆ ˆ|Бсд=PЏUšLubricants, Industrial Oils and Related Products (Class L) - Family H (Hydraulic Systems) - Specifications for Categories HH, HL, HM, HR, HV and HG-First EditionTUšЁˆ2ˆу"ˆ ˆ|Бід=PqVšQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TVšcˆ4ˆч"ˆ ˆ|Бсд=P~WšInformation technology Security techniques Code of practice for information security management-Second EditionTWšpˆ6ˆы"ˆ ˆ|Бсд=PXšInformation technology - Security techniques - Information security management systems -!Requirements-First EditionTXšsˆ8ˆэ"ˆ ˆ|Бсд=PгYšElectromagnetic Compatibility (EMC) - Part 4-2: Testing and Measurement Techniques - Electrostatic Discharge Immunity Test-Edition 1.2; Edition 1:1995 Consolidated with Amendments 1:1998 and 2:2000TYšХˆ:ˆё"ˆ ˆ|Бід=PгZšElectromagnetic Compatibility (EMC) - Part 4-2: Testing and Measurement Techniques - Electroqtatic Discharge Immunity Test-Edition 1.2; Edition 1:1995 Consolidated with Amendments 1:1998 and 2:2000TZšХˆ<ˆѓ"ˆ ˆ|Бід=Pг[šElectromagnetic Compatibility (EMC) - Part 4-2: Testing and Measurement Techniques - Electrostatic Discharge Immunity Test-Edition 1.2; Edition 1:1995 Consolidated with Amendments 1:1998 and 2:2000T[šХˆ>ˆі"ˆ ˆ|Бсд=P€\šInsert, Screw Uhread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340T\šrˆ@ˆџ"ˆ ˆ|Бсд=PQ]šCastings, Classification and Inspection of-Superseding AMS-STD-2175T]šCˆBˆ#ˆ ˆ|Бсд=P^šЏ^šLubricants, Industrial Oils and Related Products (Class L) - Family H (Hydraulic Systems) - Specifications for Categories HH, HL, HM, HQ, HV and HG-First Edition\šrˆ@ˆџ"ˆ ˆ|Бсд=P]šQ]šCastings, Classification and Inspection of-Superseding AMS-STD-2175T]šCˆBˆ#ˆ ˆ|Бсд=P5/12/14A Division of AMEC Americas LimitedA Division of AMEC Americas LimitedajЗcуМh•An™EЧsЎџЋ,иY™EѕЁQ§<ш”@ь€,Е a Ї S * ж ­ Y јЄ3п‹ Й8ф^ ЌXй…В1н\Д`џJ˜йn ‰9tŽ…T^šЁˆD #‰ ‰|Бсд=P~pšSecurities and Related Financial Instruments - Classification of Financial Instruments (CFI Code)-Second EditionTpšp‰‰+#‰ ‰|Бсд=PlqšGeneral requirements for the competence of testing and calibration laboratories-Second editionTqš^‰‰/#‰ ‰|Бід=PlršGeneral requirements for the competence of testing and calibration laboratories-Second editionTrš^‰‰1#‰ ‰|Бід=PlsšGeneral requirements for the competence of testing and calibration laboratories-Second editionTsš^‰‰3#‰ ‰|Бід=P~tšSecurities and Related Financial Instrumentr - Classification of Financial Instruments (CFI Code)-Second EditionTtšp‰ ‰7#‰ ‰|Бсд=PdušStorage of Hydrocarbons in Underground Formations-First Edition; Update No. 1: 03/2004TušV‰ ‰G#‰ ‰|Бсд=PdvšStorage of Hydrocarbons in Underground Formations-First Edition; Update No. 1: 03/2004TvšV‰ ‰J#‰ ‰|Бсд=PŠwšCode Clinic for Study of API Standard 1104 Nineteenth Edition Welding of Pipelines and Related Facilities - Reference ManualTwš|‰‰N#‰ ‰|Бсд=Pl‰šGeneral requirements for the competence of testing and calibration laboratories-Second editionT‰š^‰‰m#‰ ‰|Бід=PlŠšGeneral requirements for the competence of testing and calibration laboratories-Second editionTŠš^‰‰o#‰ ‰|Бід=Pl‹šGeneral requirements for the competence of testing and calibration laboratories-Second editionT‹š^‰‰r#‰ ‰|Бід=PuŒšStandard Specification for General Requirements for Steel Sheet, Metallic-Coated by the Hot-Dip ProcessTŒšg‰‰v#‰ ‰|Бсд=PšStbndard Specification for Steel, Sheet, Carbon, Structural, and High-Strength, Low-Alloy, Hot-Rolled and Cold-Rolled, General Requirements forTš‰‰x#‰ ‰|Бсд=PrŽšWelding of thermoplastics - Machines and equipment for hot gas welding (including extrusion welding)TŽšd‰‰#‰ ‰|Бід=PƒšBanking - Secure Cryptographic Devices (Retail) - Part 1: Concepts, Requirenents and Evaluation Methods-First EditionTšu‰‰…#‰ ‰|Бід=PƒšBanking - Secure Cryptographic Devices (Retail) - Part 1: Concepts, Requirements and Evaluation Methods-First EditionTšu‰‰‡#‰ ‰|Бід=Pт‘šReciprocating Internal Combustion Engines - Performance - Part 1: Declarations of Power, Fuel and Lubricating Oil Consumptions, and Test Methods - Additional"Requirements for Engines for General Use-Fifth EditionT‘šд‰!‰“#‰ ‰|Бід=Pт’šReciprocating Internal Combustion Engines - Performance - Part 1: Declarations of Power, Fuel and Lubricating Oil Consumptions, and Test Methods - Additional Requirements for Engines for General Use-Fifth EditionT’šд‰#‰•#‰ ‰|Бід=Pˆ“šReciprocating Internal Combustion Engines - Performance - Part 3: Test Measurements Second Edition; (NZS/ISO 3046.3: 1989)T“šz‰%‰—#‰ ‰|Бсд=Pa”šEnvironmental management systems Requirements with guidance for use-Second EditionT”šS‰'‰›#‰ ‰|Бід=Pa•šEnvironmental management systems Requirements with guidance for use-Second EditionT•šS‰)‰#‰ ‰|Від=Pa–šEnvironmental management systems Requirements with guidance for use-Second EditionT–šS‰+‰Ÿ#‰ ‰|Бід=Pa—šEnvironmental management systems Requirements with guidance for use-Second EditionT—šS‰-‰Ё#‰ ‰|Бсд=P™˜šInformation technology - Generic coding of moving pictures and associated audio information: Systems AMENDMENT 4: ISAN and V-ISAN"use in the content labelling descriptor-Second Edition; Technical Corrigendum 1: 03/01/2002; Technical Corrigendum 2: 12/01/2002; Amendment 1: 08/01/2003; Amendment 2: 02/15/2004; Amendment 3: 11/01/2004; Technical Corrigendum 3: 06/15/2005; Amendment 4: 07/01/2005T˜š‹‰/‰Ј#‰ ‰|Бід=PT™šQuality Management Systems - Fundamentals and Vocabulary-Third EditionT™šF‰1‰Ќ#‰ ‰|Бтд=PTšš.Standard Practice for Radiographic Examination`ВnF0ВсКЉ@` Q›šCastings, Classification and Inspection of-Superseding AMS-STD-2175T›šC‰4‰В#‰ ‰|Бсд=PTœšInstallation of Ceramic Tile htЉGXfЉGtВсtЉG,Гс‡™GаЈёCašEnvironmental management systems Requirements with guidance for use-Second EditionTšS‰7‰Л#‰ ‰~Бсд=PažšEnvironmental management systems Requirements with guidance for use-Second EditionTžšS‰9‰Н#‰ ‰|Бсд=P|ŸšStandard Specification for Steel Sheet, Electrolytic Zinc-Coated, for Light Coating Weight (Mass) ApplicationsTŸšn‰;‰Т#‰ ‰|Бсд=PlЩЉGeneral requirements for the competence of testing and calibration laboratories-Second editionTЩЊ^‰=‰Ь#‰ ‰|Бд=PVЪЉQuality Management Systems - Guidelines for Quality Plans-Second EditionTЪЉH‰?‰б#‰ ‰|Бд=PoмЉFood safety management systems Requirements for any organization in the food chain-ISO 22000:2005TмЉa‰A‰я#‰ ‰|Б†д=PPнЉCIE Standard Illuminants for Colorimetry-Second Edition;"CIE S 005TнЉB‰C‰ї#‰ ‰|Бд=PTоЉ>Requirements for Soldered Electrical and Electronic AssembliesVпЉAcceptability for Electronic Assemblies-Incorporates Errata: May 1, 2005TпЉH‰F‰џ#‰ ‰|Б†д=PрЉOрЉRequirements and Acceptance for Cable and Wire Harness AssembliesTрЉA‰H‰$‰ ‰|Б†д=P‰ ‰|Бд=PTоЉ>Requirements for Soldered Electrical and Electronic AssembliesпЉVпЉAcceptability for Electronic Assemblies-Incorporates Errata: May 1, 2005TпЉH‰F‰џ#‰ ‰|Б†д=P 0 љFш8Р#G$G@$G€$GР$G%G@%GИiБ] ЙeіЂLјŒ8МhГRўЊYБ] pЛgВQ§œHРlŠ6T } ) І R р Œ я › & вfІRц’ДPќ˜DЦrВFђ†2Д`џL˜й‹ыŠ:_V…0сЉDocument management - Electronic document file format for long-term preservation - Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionTсЉŠŠ$Š Š|Б†д=PтЉData Elements and Interchange Formats - Information Interchange - Representation of Dates and Times-Third EditionTтЉqŠŠ $Š Š|Бд=PlуЉGeneral requirements for the competence of testing and calibration laboratories-Second editionTуЉ^ŠŠ$Š Š|Бд=PlфЉGeneral requirements for the competence of testing and calibration laboratories-Second editionTфЉ^ŠŠ$Š Š|Бд=PlхЉGeneral requirements for the competence of testing and calibration laboratories-Second editjonTхЉ^ŠŠ$Š Š|Б†д=PlцЉGeneral requirements for the competence of testing and calibration laboratories-Second editionTцЉ^Š Š$Š Š|Б†д=PlчЉGeneral requirements for the competence of testing and calibration laboratories-Second editionTчЉ^Š Š$Š Š|Б†д=P\шЉMinimum Design Loads for Bujldings and Other Structures-Including Supplement 1TшЉNŠŠ$Š Š|Бд=P\щЉMinimum Design Loads for Buildings and Other Structures-Including Supplement 1TщЉNŠŠ$Š Š|Бд=P\ъЉMinimum Design Loads for Buildings and Other Structures-Including Supplement 1TъЉNŠŠ!$Š Š|Бд=P\ыЉMinimum Desjgn Loads for Buildings and Other Structures-Including Supplement 1TыЉNŠŠ#$Š Š|Бд=P\ьЉMinimum Design Loads for Buildings and Other Structures-Including Supplement 1TьЉNŠŠ%$Š Š|Бд=PlэЉGeneral requirements for the competence of testing and calibration laboratories-Second editionTэЉ^ŠŠ*$Š Š|В†д=PlюЉGeneral requirements for the competence of testing and calibration laboratories-Second editionTюЉ^ŠŠ,$Š Š|Б†д=PlяЉGeneral requirements for the competence of testing and calibration laboratories-Second editionTяЉ^ŠŠ.$Š Š|Б†д=Pƒ№ЉInformation Technology - Software Life Cycle Processes-First Edition; Amendment 1: 5/01/2002; Amendment 2: 21/01/2004T№ЉuŠŠ2$Š Š|Бд=PlёЉInformation Technology - Guide for ISO/IEC 12207 (Software Life Cycle Processes)-First EditionTёЉ^Š Š4$Š Š|Бд=PsђЉSoftware Engineering - Guide for the Application of ISO/IEC 12207 to Project Management-First EditionTђЉeŠ"Š6$Š Š|Бд=PaѓЉEnvironmental"management systems Requirements with guidance for use-Second EditionTѓЉSŠ$Š;$Š Š|Бд=PaєЉEnvironmental management systems Requirements with guidance for use-Second EditionTєЉSŠ&Š=$Š Š|Бд=PiѕЉFibre-reinforced plastic composites - Determination of flexural properties (ISO 14125:1998)TѕЉ[Š(Š@$Š Š|Бд=PТіЉTextile glass-reinforced plastics - Prepregs, moulding compounds and laminates - Determination of the textile-glass and mineral-filler content - Calcination methods (ISO 1172:1996)TіЉДŠ*ŠB$Š Š|Бд=P‡їЉSelf-Propelled Elevating Work Platforms-Second Edition; General Instruction No 1; Update No 2; Supersedes B354.3-M82-CAN3TїЉyŠ,ŠM$Š Š|БЛд=PUјЉCertification Manual for Welding Inspectors-Fourth Edition; Errata 2000TјЉGŠ.ŠR$Š Š|Буд=PUљЉCertification Manual for Welding Inspectors-Fourth Edition; Errata 2000TљЉGŠ0ŠV$Š Š|БЛд=PvњЉConformity Assessment - General Requirements for Bodies Operating Certification of Persons-First EditionTњЉhŠ2ŠZ$Š Š|Быд=PvћЉConformity Assessment - General Requirements for Bodies Operating Certification of Persons-First EditionTћЉhŠ4Š\$Š Š|Буд=PdќЉPhotography - Electronic Still-Picture Cameras - Resolution Measurements-First EditionTќЉVŠ6Š`$Š Š|Б†д=PГ§ЉOptics and Optical Instruments - Optical Transfer Function - Principles of Measurement nf Modulation Transfer Function (MTF) of Sampled Imaging Systems-First EditionT§ЉЅŠ8Šb$Š Š|Б†д=PuўЉOptics and Optical Instruments - Accuracy of Optical Transfer Function (OTF) Measurement-First Edition;TўЉgŠ:Šd$Š Š|Б†д=PkџЉPeinture Aux Resines Vinyliques, Antisalissure, Pour Carenes-Modificatif No. 1 Septembre 1998TџЉ]Š<Šh$Š Š|Бд=PЊNorth American Specification for the Design of Cold-Formed Steel Structural Members-Sixth Edition; Update No 1; Update No 2; Supplement 1: 2004TЊŠ>Šm$Š Š|Блд=PЊNorth American Specification for the Design of Cold-Formed Steel Structural Members-Sixth Edition; Update No 1; Update No 2; Supplement 1: 2004TЊŠ@Šq$Š Š|Быд=PЊInformation technology - Security techniques - Information security management systems - Requirements-First EditionTЊsŠBŠu$Š Š|Быд=P~ЊInformation technology Security techniques Code of practice for information security management-Second EditionTЊpŠDŠw$Š Š|Быд=PpЊMetric Machine Screws-2000 Edition; Revision of ASME B18.6.7M-1:85(1993); Supersedes IFI 513: 1981TЊbŠFŠ{$Š Š|Буд=PpЊMetric Machine Screws-2000 Edition; Revision of ASME B18.6.7M-1985(1993); Supersedes IFI 513: 1981TЊbŠHŠ}$Š Š|Блд=PЊOЊFIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderTЊAŠJŠ$Š Š|БЛд=P1993); Supersedes JFI 513: 1981TЊbŠFŠ{$Š Š|Буд=PЊpЊMetric Machine Screws-2000 Edition; Revision of ASME B18.6.7M-1985(1993); Supersedes IFI 513: 1981TЊbŠHŠ}$Š Š|Блд=P—Hцv"В^рŒ ЗЦ)еjЁMšFтŽФNњЅQќЈ!Э ЗNњ™Eф   Щ ] † 2 Ц r  В F ђ–Bц’6т†2ж‚ТV–Bж‚ТCя`џD˜й“х‹;orи2ЊISO STANDARDS COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISO 14001, 14004, 14010, 14011, 14012, DIS 14015, 14020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041, 14042, 14043, TR 14049, 14050, AND TR 14061; SEE ALSO ISO 14000 SERIES AND CDTЊ$‹‹†$‹ ‹|Б†д=P2ЊISO STANDARDS COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISO 14001, 14004, 14010, 14011, 14012, DIS 14015, 14020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041, 14042, 14043, TR 14049, 14050, AND TR 14061; SEE ALSO ISO 14000 SERIES AND CDTЊ$‹‹‰$‹ ‹|Б†д=P2 ЊISO STANDARDS COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISO 14001, 14004, 14010, 14011. 14012, DIS 14015, 14020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041, 14042, 14043, TR 14049, 14050, AND TR 14061; SEE ALSO ISO 14000 SERIES AND CDT Њ$‹‹‹$‹ ‹|Б†д=PO ЊSpecification for Welding Procedure and Performance QualificationT ЊA‹‹Ž$‹ ‹|Быд=P_ЊInformation technology - Service management - Part 1: Specification-First EditionTЊQ‹‹Ќ$‹ ‹|Б†д=PbЊInformation technology - Service management - Part 2: Code of practice-First EditionTЊT‹ ‹Ў$‹ ‹|Бд=PTЊ?Planification Des Mesures DДUrgence Pour LДIndustrie-Fiche No 1TЊ?Planification Des Mesures DДUrgence Pour LДIndustrie-Fiche No 1O ЊFIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderT ЊA‹‹И$‹ ‹|Б†д=PP!ЊGeographic information Rules for application schema-First EditionT!ЊB‹‹Н$‹ ‹|Б†д=P№"ЊAccuracy (trueness and precision) of measurement methods and results - Part 2: Basic method for the determination of repeatability and reproducibility of a standard measurement method-Premiere щdition; Corrigendum 1: 5/15/2002T"Њт‹‹С$‹ ‹|Бд=P№#ЊAccuracy (trueness and precision) of measurement methods and results - Part 2: Basic method for the determination of repeatability and reproducibility of a standard measurement method-Premiere щdition; Corrigendum 1: 5/15/2002T#Њт‹‹У$‹ ‹|Бд=Pa$ЊEnvironmental management systems Requirements with guidance for use-Second EditionT$ЊS‹‹Ш$‹ ‹|БЛд=Pl%ЊGeneral requirements for the competence of testing and calibration laboratories-Second editionT%Њ^‹‹Ь$‹ ‹|Блд=Pl&ЊGeneral requirements for the competence of testing and calibration laboratories-Second editionT&Њ^‹‹Ю$‹ ‹|Блд=Pa'ЊEnvironmental management systems Requirements with guidance for use-Sebond EditionT'ЊS‹‹г$‹ ‹|БЛд=Pl(ЊGeneral requirements for the competence of testing and calibration laboratories-Second editionT(Њ^‹‹й$‹ ‹|БЛд=Po)ЊFood safety management systems Requirements for any organization in the food chain-First EditionT)Њa‹ ‹л$‹ ‹|Буд=Pl*ЊGeneral requirenents for the competence of testing and calibration laboratories-Second editionT*Њ^‹"‹у$‹ ‹|Буд=Po+ЊFood safety management systems Requirements for any organization in the food chain-First EditionT+Њa‹$‹ч$‹ ‹|Б†д=Po,ЊFood safety management systems Requirements for any organization in the food chain-First EditionT,Њa‹&‹щ$‹ ‹|Б†д=Po-ЊFood safety management systems Requirements for any organization in the food chain-First EditionT-Њa‹(‹ъ$‹ ‹|Б†д=Po.ЊFood safety management systems Requirements for any organization in the food chain-First EditionT.Њa‹*‹ь$‹ ‹|Б†д=Po/ЊFood safety management systems Requirements for any organization in the food chain-First EditionT/Њa‹,‹ю$‹ ‹|Б†д=Po0ЊFood safety management systems Requirements for any organization in the food chain-First EditionT0Њa‹.‹№$‹ ‹|Буд=Po1ЊFood safety management systems Requirements for any organization in the food chain-First EditionT1Њa‹0‹ђ$‹ ‹|Блд=PT2Њ1Cabinets, Racks, Panels, and Associated Equipment2мH0ВыКЉ@` T3Њ0Standard Methods for Mechanical Testing of Welds`2мH0ВуКЉ@` 4ЊMedical devices Quality management systems Requirements for regulatory purposes-Second Edition; ISO 13485: 1996T4Њq‹4‹%‹ ‹|БЛд=PT5Њ<Identification cards Physical characteristics-Third Edition  T6Њ@Identification Cards - Financial Tranraction Cards-Fifth EditionZ7ЊIdentification Cards - Recording Technique - Part 1: Embossing-Third EditionT7ЊL‹8‹%‹ ‹|Буд=PХ8ЊIdentification Cards - Recording Technique - Part 2: Magnetic Stripe - Low Coercivity-Third Edition; Cancels and Replaces ISO/IEC 7811-2:1995, ISO/IEC 7811-4:1995, ISO/IEC 7811-5:1995T8ЊЗ‹:‹%‹ ‹|Буд=Pе9ЊIdentification cbrds - Recording technique - Part 6: Magnetic stripe - High coercivity-Second Edition; Cancels and Replaces ISO/IEC 7811-6:1996 and ISO/IEC 7811-4 thru 5:1995; Amendment 1: 10/01/2005T9ЊЧ‹<‹%‹ ‹|Буд=Pе:ЊIdentification cards - Recording technique - Part 6: Magnetic stripe - High coercivity-Second Edition; Cancels and Replaces ISO/IEC 7811-6:1996 and ISO/IEC 7811-4 thru 5:1995; Amendment 1: 10/01/2005T:ЊЧ‹>‹%‹ ‹|Б†д=P};ЊIdentification cards Recording technique Part 7: Magnetic stripe High coercivity, high density-First EditionT;Њo‹@‹%‹ ‹|Б†д=P<ЊIdentification Cards - Identification of Issuers - Part 1: Numbering System-Second Edition; Technical Corrigendum 1: 12-15-2001T<Њ‹B‹%‹ ‹|Бд=Pards Recording techniquf Part 7: Magnetic stripe High coercivity, high density-First EditionT;Њo‹@‹%‹ ‹|Б†д=P<Њ<ЊIdentification Cards - Identification of Issuers - Part 1: Numbering System-Second Edition; Technical Corrigendum 1: 12-15-2001№?№?№?HZ™lb‘А3п ЖсШtЦrŸKїЃ4рqЎZы—(дeЂNтŽЫ_ Њ V ъ – * ж u ! 1 н э™IѕІRўЊHє•Aђžlц’`џI˜йY#Œ<’Рa=ЊIdentification Cards - Identification of Issuers - Part 1: Numbering System-ISO/IECT=ЊSŒŒ%Œ Œ|Бд=P>ЊIdentification Cards - Identification of Issuers - Part 2: Application and Registration Procedures-Second EditionT>ЊqŒŒ%Œ Œ|Бд=Pl?ЊGeneral requirements for the competence of testing and calibration laboratories-Second editionT?Њ^ŒŒ(%Œ Œ|Блд=P@ЊGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558T@ЊѓŒŒ,%Œ Œ|Бд=PAЊGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558TAЊѓŒŒ2%Œ Œ|БЛд=PqBЊQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TBЊcŒ Œ:% Œ|БЛд=PTCЊQuality Management Systems - Fundamentals and Vocabulary-Third EditionTCЊFŒ Œ>%Œ Œ|Буд=PlDЊGeneral requirements for the competence of testing and calibration laboratories-Second editionTDЊ^ŒŒB%Œ Œ|Быд=PlEЊGeneral requirements for the competence of testing and calibration laboratories-Second editionTEЊ^ŒŒD%Œ Œ|Блд=PlFЊGeneral requirements for the competence of testing and calibration laboratories-Second editionTFЊ^ŒŒN%Œ Œ|Быд=PlGЊGeneral requirements for the competence of testing and calibration laboratories-Second editionTGЊ^ŒŒR%Œ Œ|Быд=PlHЊGeneral requirements for the competence of testing!and calibration laboratories-Second editionTHЊ^ŒŒT%Œ Œ|Быд=PгIЊSafety Color Code - environmental Facility Safety Signs - Criteria for Safety Symbols - Product Safety Sign & Labels and Accident Prevention Tags-Contains Z535.1, Z535.2, Z535.3, Z535.4, and Z535.5TIЊХŒŒ_%Œ Œ|Буд=PTJЊ/Procedure for Testing Flammability of MaterialsTKЊ/PROCEDURE FOR TESTING FLAMMABILITY OF MATERIALSHРю?Hh^ѓH4ВЛКЉ@lLЊGeneral requirements for the competence of testing and calibration laboratories-Second editionTLЊ^ŒŒi%Œ Œ|Б†д=P^MЊPlastics - Generic Identification and Marking of Plastic Products-Second EditionTMЊPŒŒo%Œ Œ|Б†д=P^NЊPlastics - Generic Identification and Marking of Qlastic Products-Second EditionTNЊPŒ Œq%Œ Œ|Б†д=POЊGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558TOЊѓŒ"Œt%Œ Œ|БЛд=PuPЊDocumentation - Guidelines for the Establiqhment and Development of Monolingual Thesauri Second EditionTPЊgŒ$Œz%Œ Œ|Блд=P…QЊDocumentation - Methods for Examining Documents, Determining Their Subjects, and Selecting Indexing Terms First EditionTQЊwŒ&Œ|%Œ Œ|Блд=PRЊDocument management - Electronic document file format for long-term preservation - Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionTRЉŒ(Œ~%Œ Œ|Блд=PeSЊSpecification for Carbon Steel Electrodes for Shielded Metal Arc Welding-Errata: 9/2004TSЊWŒ*Œˆ%Œ Œ|Буд=PeTЊSpecification for Carbon Steel Electrodes for Shielded Metal Arc Welding-Errata: 9/2004TTЊWŒ,ŒŒ%Œ Œ|Быд=PeUЊSpecification for Carbon Steel Electrodes for Shieleed Metal Arc Welding-Errata: 9/2004TUЊWŒ.Œ%Œ Œ|Блд=PeVЊSpecification for Carbon Steel Electrodes for Shielded Metal Arc Welding-Errata: 9/2004TVЊWŒ0Œ”%Œ Œ|Б†д=PeWЊSpecification for Carbon Steel Electrodes for Shielded Metal Arc Welding-Errata: 9/2004TWЊWŒ2Œš%Œ Œ|Бд=PЕiЊMedical eevices Symbols to be used with medical device labels, labelling and information to be supplied-First Edition: Amendment 1: 8/01/2002; Amendment 2: 02/15/2004TiЊЇŒ4ŒЕ%Œ Œ|Буд=PЕjЊMedical devices Symbols to be used with medical device labels, labelling and information to be supplied-First Edition: Amendment 1: 8/01/2002; Amendment 2: 02/15/2004TjЊЇŒ6ŒЗ%Œ Œ|Буд=PTkЊ=Graphical Symbols for Use in the Labelling of Medical DevicesˆнHnlЊMedical devices Quality management systems Requirements for regulatory purposes-Second EditionTlЊ`Œ9ŒЛ%Œ Œ|Блд=PamЊEnvironmental management systems Requirements with guidance for use-Second EditionTmЊSŒ;ŒП%Œ Œ|Быд=PunЊDocumentation - Guidelines for the Establisiment and Development of Monolingual Thesauri Second EditionTnЊgŒ=ŒУ%Œ Œ|БЛд=POoЊFIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderToЊAŒ?ŒЭ%Œ Œ|Буд=POpЊFIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderTpЊAŒAŒб%Œ Œ|Б†д=POqЊFIXED LADDERS - SAFETY REQUIQEMENTS-Now Copyrighted by ALI/LadderTqЊAŒCŒг%Œ Œ|Б†д=POrЊFIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderTrЊAŒEŒз%Œ Œ|Быд=PsЊІsЊSmall Craft - Stability and Buoyancy Assessment and Categorization - Part 1: Non-Sailing Boats of Hull Length Greater than or Equal to 6 m-First EditionTsЊ˜ŒGŒн%Œ Œ|Блд=P Œ|Б†д=PrЊOrЊFIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderTrЊAŒEŒз%Œ Œ|Быд=PЇЇ@8БЅ\у˜2ЇЇ2а4@<ЙG\у˜2ЇЇ@8БЅЯ)Чx$е2о;ЦrНOћЇђžщ•0мw#ОjБLјi<ЧsrР l  К N њ І R  + П k џЋ?ы+ПkУRў§ЉЈTш”С`џI˜йŽю<l‚쓇tЊSmall Craft - Windows, Portlights, Hatches, Deadlights and Doors - Strength and Watertightness Requirements-First EditionTtЊyп% |Блд=PYuЊSmall Craft - Watertight Cockpits and Quick-Draining Cockpits-First EditionTuЊKт% |Блд=PЖvЊInformation technology Automatic identification and data capture techniques Bar code verifier conformance specification Part 2: Two-dimensional symbols-First EditionTvЊЈщ% |Буд=PЌwЊInformation technology Automatic identification and data capture techniques Bar code print quality test specification Two-dimensional symbols-First EditionTwЊžы% |Буд=PgxЊEnvironmental Labels and Declarations - General Principles-First Edition; ISO 14020: 1998TxЊYя% |Б†д=PTyЊ,Electrical Standard for Industrial MachineryP€GITzЊ,Electrical Standard for Industrial MachineryP€GIˆ{ЊEarth-Moving Machinery - Zones of Comfort and Reach for Controls (CEN EN ISO 6682: 1995)-Second Edition; Amendment 1: 1989T{Њzљ% |Быд=Pˆ|ЊEarth-Moving Machinery - Zones of Comfort and Reach for Controls (CEN EN ISO 6682: 1995)-Second Edition; Amendment 1: 1989T|Њz§% |Быд=Pf}ЊStandard for Automobile Theft Deterrent Equipment and Systems: Electronic ImmobilizationT}ЊX& |Бд=Pe~ЊPersonal financial planning Requirements for personal financial planners-First EditionT~ЊW& |Блд=PlЊGeneral requirements for the competence of testing and calibration laboratories-Second editionTЊ^ & |Блд=PT€ЊQuality Management Systems - Fundamentals and Vocabulary-Third EditionT€ЊF& |Блд=PeЊISO 9000:"ISO STANDARDS COLLECTION ON CD-ROM - QUALITY MANAGEMENT-SEE ALSO ISO 14000 CDTЊW& |Буд=PT‚Њ/Eye and Face Protectors-Sixth Edition: Update 1H0г1H0ВлКЉ@ˆ TƒЊ/Eye and Face Protectors-Sixth Edition: Update 1H0г1H0ВлКЉ@ˆ T„Њ/Eye and Face Protectors-Sixth Edition: Update 1H0г1H0ВлКЉ@ˆ T…Њ/Eye and Face Protectors-Sixth Edition: Update 1H0г1H0ВлКЉ@ˆ T†Њ.Eye and Face Protectors-Sixth Edition: Update 1H0г1H0ВлКЉ@ˆ T‡Њ/Eye and Face Protectors-Sixth Edition: Update 1H0г1H0ВлКЉ@ˆ TˆЊ/Eye and Face Protectors-Sixth Edition: Update 1GpўH(ИoH4ВлКЉ@T‰Њ/Eye and Face Protectors-Sixth Edition: Update 1GpўH(ИoH4ВлКЉ@qŠЊQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TŠЊc"1& |Вд=Pq‹ЊQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T‹Њc$5& |Б†д=P}ŒЊAcoustics - Hearing Protectors - Subjective Method for the Measurement of Sound Attenuation (ISO 4896-1 : 1990)TŒЊo&9& |БЛд=PЙЊAcoustics - Hearing Protectors - Part 2: Estimation of Effective A-Weighted Sound Prersure Levels When Hearing Protectors Are Worn First Edition; (CEN EN ISO 4869-2: 1995)TЊЋ(;& |Блд=PТŽЊAcoustics - Hearing Protectors Part 3: Simplified Method for the Measurement of Insertion Loss of Ear-Muff Type Protectors for Quality Inspection Purposes (ISO/TR 4869-3: 1989) (N)TŽЊД*=& |Блд=PzЊSpecification for Spring retaining rings Part 2: Barbon Steel E Clips-AMD 2: May, 1968; AMD 976: June, 1972TЊl,A& |Буд=PqЊQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TЊc.E& |Блд=Ps‘ЊOrganization and Procedures for Standardization of Oilfield Equipment and Materials-Twentieth EditionT‘Њe0I& |Б†д=Ps’ЊOrganization and Procedures for Standardization of Oilfield Equipment and Materials-Twentieth EditionT’Њe2K& |Быд=PЄ“ЊSpecification for Quality Programs for the Petroleum, Petrochemical and Natural Gas Industry-Seventh Edition; Errata: August 2003/ISO TS29001 AdoptionT“Њ–4M& |БЛд=PК”ЊGraphical Symbols - Safetz Colours and Safety Signs - Part 1: Design Principles for Safety Signs in Workplaces and Public Areas-First Edition; Corrected Version: 12/15/2003T”ЊЌ6R& |Б†д=Pl•ЊGeneral requirements for the competence of testing and calibration laboratories-Second editionT•Њ^8V& |Быд=Pl–ЊGeneral requirements for the competence of testing and calibration laboratories-Second editionT–Њ^:X& |БЛд=Pl—ЊGeneral requirements for the competence of testing and calibration laboratories-Second editionT—Њ^<b& |БЛд=P˜ЊAnimal and Vegetable Fats and Oils - Determination of Acid Value and Acidity-Second Edition; Amendment 1: 3/15/2003T˜Њs>f& |Б†д=PR™ЊCELLULAR ELASTOMER, GASKET ***TO BE USED WITH FORD WSS-M99P1111-A***T™ЊD@j& |Блд=PЮšЊAnimal and Vegetable Fats and Oils - Determination of Unsaponifiable Matter - Method Using Diethyl Ether Extraction-First Edition; Cancels and Replaces ISO 3596-1:1988 and its Amendment 1:1997TšЊРBn& |Блд=P’›ЊAnimal and Vegetable Fats and Oils - Determinavion of Insoluble Impurities Content-Third Edition; Corrected and Reprinted 02/01/2001T›Њ„Dp& |Блд=PwœЊAnimal and Vegetable Fats and Oils - Determination of Moisture and Volatile Matter Content-Second EditionTœЊiFr& |Блд=PЊlЊGeneral requirements for the competence of testing and calibration laboratories-Second edition›Њ„Dp& |Блд=PœЊwœЊAnimal and Vegetable Fats and Oils - Determination of Moisture and Volatile Matter Content-Second EditionTœЊiFr& |Блд=P‚ ЉUУoЁMћЇ&вfІRц’и„рŒХRў9ПkЉUœHЫwВ A э ™ E ё  I ѕ Ё M ш ” @ ь€,Чs Й1нU­Yђžђžш”;ч`џD˜й@FŽ=6‰TЊ^Hz&Ž Ž|Быд=PlžЊGeneral requirements for the competence of testing and calibration laboratories-Second editionTžЊ^ŽŽ}&Ž Ž|Буд=PlŸЊGeneral requirements for the competence of testing and calibration laboratories-Second editionTŸЊ^ŽŽ&Ž Ž|Быд=Pk ЊStandard Specification for Zinc Coating (Hot-Dip) on Iron and Steel Hardware-AASHTO No.: M232T Њ]ŽŽ…&Ž Ž|Бд=PlЁЊSection 2 - Acceptable Means Of Compliance (AMC)/Interpretative And Explanatory Material (IEM)TЁЊ^ŽŽŽ&Ž Ž|Блд=PlЂЊSection 2 - Acceptable Means Of Compliance (AMC)/Interpretativf And Explanatory Material (IEM)TЂЊ^Ž Ž&Ž Ž|Блд=PlЃЊSection 2 - Acceptable Means Of Compliance (AMC)/Interpretative And Explanatory Material (IEM)TЃЊ^Ž Ž“&Ž Ž|Блд=PlЄЊSection 2 - Acceptable Means Of Compliance (AMC)/Interpretative And Explanatory Material (IEM)TЄЊ^Ž Ž”&Ž Ž|Блд=PlЅЊGeneral requirements for the competence of testing and calibration laboratories-Second editionTЅЊ^ŽŽ—&Ž Ž|Б†д=P}ІЊBuilding Code Requirements for Structural Concrete (ACI 318-05) and Commentary (ACI 318R-05)-Errata: 08/11/2005TІЊoŽŽ›&Ž Ž|Блд=P}ЇЊBuilding Code Requirements for Structural Concrete (ACI 318-05) and Commentary (ACI 318R-05)-Errata: 08/11/2025TЇЊoŽŽ&Ž Ž|Блд=P}ЈЊBuilding Code Requirements for Structural Concrete (ACI 318-05) and Commentary (ACI 318R-05)-Errata: 08/11/2005TЈЊoŽŽŸ&Ž Ž|Блд=P}ЉЊBuilding Code Requirements for Structural Concrete (ACI 318-05) and Commentary (ACI 318R-05)-Errata: 08/11/2005TЉЊoŽŽ &Ž Ž|Блд=P}ЊЊBuilding Code Requirements for Structural Concrete (ACI 318-05) and Commentary (ACI 318R-05)-Errata: 08/11/2005TЊЊoŽŽЂ&Ž Ž|Быд=PlЋЊGeneral requirements for the competence of testing and calibration laboratories-Second editionTЋЊ^ŽŽІ&Ž Ž|Быд=POЌЊFIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderTЌЊAŽŽЎ&Ž Ž|БЛд=Pl­ЊGeneral requirements for the competence of testing and calibration laboratories-Second editionT­Њ^ŽŽВ&Ž Ž|Буд=PlЎЊGeneral requirements for the competence of testing and calibration laboratories-Second editionTЎЊ^Ž!ŽД&Ž Ž|Блд=P‡ЏЊOptics and Optical Instruments - Preparation of Drawings for Optical Enements and Systems - Part 1: General First EditionTЏЊyŽ#ŽК&Ž Ž|Б†д=PЙАЊOptics and photonics Preparation of drawings for optical elements and systems Part 10: Table representing data of optical elements and cemented assemblies-Second EditionTАЊЋŽ%ŽМ&Ž Ž|Буд=P­БЊOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 2: Material Imperfections - Stress Birefringence First EditionTБЊŸŽ'ŽО&Ž Ž|Буд=PЏВЊOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 3: Material Imperfections - Bubbles and Inclusions First EditionTВЊЁŽ)ŽР&Ž Ž|Буд=PБГЊOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems . Part 4: Material Imperfections - Inhomogeneity and Striae-First EditionTГЊЃŽ+ŽТ&Ž Ž|Буд=PБДЊOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 4: Material Imperfections - Inhomogeneity and Striae-First EditionTДЊЃŽ-ŽФ&Ž Ž|Буд=PЗЕЊOptics and Optical Instruments - Preparation of Drawings for Optical Elements anf Systems - Part 6: Centring Tolerances-First Edition; Technical Corrigendum 1:04/01/1999TЕЊЉŽ/ŽХ&Ž Ž|Буд=PЏЖЊOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 3: Material Imperfections - Bubbles and Inclusions First EditionTЖЊЁŽ1ŽЧ&Ž Ž|Буд=PЗЗЊOptics and Optical Instruments - Preparation of Drawings for Opticbl Elements and Systems - Part 6: Centring Tolerances-First Edition; Technical Corrigendum 1:04/01/1999TЗЊЉŽ3ŽШ&Ž Ž|Буд=PЗИЊOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 6: Centring Tolerances-First Edition; Technical Corrigendum 1:04/01/1999TИЊЉŽ5ŽЩ&Ž Ž|Бд=PЌЙЊOptics and Optical Instruments - Preparation"of Drawings for Optical Elements and Systems - Part 5: Surface Form Tolerances-First Edition; Corrigendum 1: 1996TЙЊžŽ7ŽЫ&Ž Ž|Бд=PЗКЊOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 6: Centring Tolerances-First Edition; Technical Corrigendum 1:04/01/1999TКЊЉŽ9ŽЭ&Ž Ž|Бд=PŸЛЊOptics and Optical Instruments - Rreparation of Drawings for Optical Elements and Systems - Part 7: Surface Imperfection Tolerances First EditionTЛЊ‘Ž;ŽЯ&Ž Ž|Бд=PМЊOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 8: Surface Texture-First EditionTМЊŽ=Žб&Ž Ž|Бд=PНЊOptics and Optical Instruments - Preparation of Drawings for Optical Elemenvs and Systems - Part 9: Surface Treatment and Coating First EditionTНЊŽ?Žг&Ž Ž|Бд=PЙОЊOptics and photonics Preparation of drawings for optical elements and systems Part 10: Table representing data of optical elements and cemented assemblies-Second EditionTОЊЋŽAŽе&Ž Ž|Бд=PПЊ”ПЊOptics and Optical Instruments - Preparation of Drawings for Opvical Elements and Systems - Part 11: Non-Toleranced Data First Edition Ž|Бд=PОЊЙОЊOptics and photonics Preparation of drawings for optical elements and systems Part 10: Table representing data of optical elements and cemented assemblies-Second EditionTОЊЋŽAŽе&Ž Ž|Бд=Pz ВP—CІRУoа|ХqХqКfЏ[ЌXЁMœH—C”@“?†2Ћ W ы — + з ˆ 4 Ш t ї Ѓ & вU„0Г_ѓŸ3пsГ_ѓŸ4рt Д`џH˜йx>r@TПЊ†ŽCз& |Бд=P’РЊOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 12: Aspheric Surfaces-First EditionTРЊ„к& |Бд=P СЊOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 14: Wavefront Deformation Tolerance-First EditionTСЊ’м& |Бд=P—ТЊOptics and photonics Preparation of drawings for optical elements and systems Part 17: Laser irradiation damage threshold-First editionTТЊ‰о& |Блд=PcУЊOptics and Optical Instruments - Optical Coatings - Part 1: Definitions First EditionTУЊUр& |Быд=PjФЊOptics and Optical Instruments - Optical Coatings - Part 2: Optical Properties First EditionTФЊ\ т& |Быд=PpХЊOptics and Optical Instruments - Optical Coatings - Part 3: Environmental Durability First EditionTХЊb ф& |Быд=PmЦЊOptics and Optical Instruments - Optical Coatings - Part 4: Spebific Test Methods First EditionTЦЊ_ ц& |Быд=PaЧЊEnvironmental management systems Requirements with guidance for use-Second EditionTЧЊSъ& |Блд=PaШЊEnvironmental management systems Requirements with guidance for use-Second EditionTШЊSю& |Блд=P[ЩЊReclosable Child-Resjstant Packages-Third Edition; General Instruction No.1-3TЩЊMђ& |Бд=PqЪЊQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TЪЊcі& |Блд=PqЫЊQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TЫЊcј& |Быд=PqЬЊQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TЬЊcњ& |Быд=PqЭЊQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TЭЊcќ& |Быд=PqЮЊQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994"and ISO 9003:1994TЮЊcў& |Быд=PqрЊQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TрЊc#' |Буд=P”сЊMechanical vibration and shock - Evaluation of human exposure to whole- body vibration - Part 1: General requirements-Deuxiшme щditionTсЊ†!'' |Буд=P тЊMechanical Vibration and Shock - Evaluation of Human Exposure to Whole-Body Vibration - Part 1: General Requirements-Second Edition; Replaces ISO 2631-3:1985; Corrected and Reprinted 07/15/1997; Supersedes NZS ISO 2631.1: 1985 and NZS ISO 2631.3: 1985TтЊћ#)' |Буд=P€уЊOptics and Optical Instruments - Environmental Test Methods - Part 1: Definitions, Extent of Testing First EditionTуЊr%/' |БЛд=P€фЊOptics and Optical Instruments - Environmental Test Methods - Part 1: Definitions, Extent of Testing First EditionTфЊr'1' |БЛд=PwхЊOptics and Optical Instruments - Environmental Test Methods - Part 2: Cold, Heat, Humidity-Second EditionTхЊi)3' |Быд=PtцЊOptics and Optibal Instruments - Environmental Test Methods - Part 3: Mechanical Stress-Second EditionTцЊf+5' |Бд=PlчЊOptics and Optical Instruments - Environmental Test Methods - Part 4: Salt Mist-Second EditionTчЊ^-7' |Бд=PшЊOptics and Optical Instruments - Environmental Test Methods - Part 5: Combined Cold, Low Air Pressure First EditionTшЊs/9' |Бд=PfщЊOptics and Optical Instruments - Environmental Test Methods - Part 6: Dust First EditionTщЊX1;' |Бд=PqъЊOptics and photonics Environmental test methods Part 7: Resistance to drip or rain-Second EditionTъЊc3=' |Бд=PqыЊOptics and photonics Environmental test methods Pbrt 7: Resistance to drip or rain-Second EditionTыЊc5?' |Бд=PˆьЊOptics and Optical Instruments - Environmental Test Methods - Part 8: High Pressure, Low Pressure, Immersion First EditionTьЊz7A' |Бд=PqэЊOptics and Optical Instruments - Environmental Test Methods - Part 9: Solar Radiation First EditionTэЊc9D' |Бд=P–юЊOptics and Optical Instruments - Environmental Test Methods - Part 10: Combined Sinusoidal Vibration and Dry Heat or Cold-Second EditionTюЊˆ;F' |Бд=PoяЊOptics and Optical Instruments - Environmental Test Methods - Part 11: Mould Growth First EditionTяЊa=H' |Бд=Pp№ЊOptics and Optical Instruments -"Environmental Test Methods - Part 12: Contamination First EditionT№Њb?J' |Блд=PšёЊOptics and Optical Instruments - Environmental Test Methods - Part 13: Combined Shock, Bump or Free Fall and Dry Heat or Cold-Second EditionTёЊŒAL' |Быд=PvђЊOptics and Optical Instruments - Environmental Test Methods - Part 14: Dew, Hoarfrost, Ice First EditionTђЊhCN' |Быд=PВѓЊOptics and Optical Instruments - Environmental Test Methods - Part 15: Combined Digitally Controlled Broad-Band Random Vibration and Dry Heat or Cold-Second EditionTѓЊЄEP' |Быд=PєЊЅєЊOptics and Optical Instruments - Environmental Test Methods - Part 16: Combined Bounce or Steady-State Acceleration and Dry Heat or Cold-Second Fdition |Быд=PѓЊВѓЊOptics and Optical Instruments - Environmental Test Methods - Part 15: Combined Digitally Controlled Broad-Band Random Vibration and Dry Heat or Cold-Second EditionTѓЊЄEP' |Быд=P а4Fax '2№? (ч< а4 IsaџMљƒ/•Aб}К$а_ ƒ/ОjљЅ?ыjЊVтŽУCяoО * ж e    L л ‡  Т Q §Œ8н‰(дsВ^юš0мy%Ž:šFД`џI˜йwЉmqTія}pGе |Бд=PaїяEnvironmental management systems Requirements with guidance for use-Second EditionTїяSн |Бд=P[јяHeating Fuel Oil-Amendment No. 1: March 2004; Amendment No. 2: September 2004TјяMъ |БŽд=P[љяHeating Fuel Oil-Amendment No. 1: March 2004; Amendment No. 2: September 2004TљяMь |Б?д=P[њяHeating Fuel Oil-Amendment No. 1: March 2004; Amendment No. 2: September 2004TњяM№ |Б?д=P[ћяHeating Fuel Oil-Amendment No. 1: March 2004; Amendment No. 2: September 2004TћяM ѓ |Б?д=PqќяStandard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment ProcessTќяc є |Бд=PO§яPhase I Environmental Site Assessment-Second Edition; Update No 1T§яA і |Б?д=PiўяPhase II Environmental Site Assessment-First Edition; General Instruction No 1; Update No 3Tўя[ј |Б?д=P˜џяGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TџяŠќ |Б?д=Pu№Calibration Laboratories and Measuring and Test Equipment - General Requirements-Replaces Mil-Std-45662T№gў |Бд=P q№Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T№c |Бд=Pq№Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T№c |БŽд=PT№7Quality Management Systems - Requirements-Third EditiondЇNT№7Quality Management Systems - Requirements-Third Edition/І@HЪOЪ№8mm through 200 mm Embossed Carrier Taping and 8 mm & 12 mm Punched Carrier Taping of Surface Mount Components for Automatic Handling-ANSI/EIA-481-C; Comment Period Expires: August 27,2003T№М |Б?д=PЪ№8mm through 200 mm Embossed Carrier Taping and 8 mm & 12 mm Punched Carrier Taping of Surface Mount Components for Automatic Handling-ANSI/EIA-481-C; Comment Perimd Expires: August 27,2003T№М |Бд=PT№7Quality Management Systems - Requirements-Third Edition№Quality Management and Quality Assurance - Vocabulary-ISO 8402:1994; ASQ A8402-1994 is a Revision and Redesignation of ASQ A3-1987T№‚  |БŽд=PT №7Quality Management Systems - Requirements-Third EditionКЉ@P€ №Basic Environmental Testing Procedures Part 2: Tests- Test Ka: Salt Mist-Third Edition; Corrigendum: December 1999T №r#% |Б?д=PЯ №Electromechanical Components for Electronic Equipment - Basic Testing Procedures and Measuring Methods - Part 19: Chemical Resistance Test - Section 3: Test 19c - Fluid Resistance-First EditionT №С%' |Б?д=P„ №Dispositifs antichutes, cordes d´assurance verticales et guides-Premiere Edition; Fiche No 1; Mise A Jour No 2-3T №v'+ |БŽд=P„ №Dispositifs antichutes, cordes d´assurance verticales et guides-Premiere Edition; Fiche No 1; Mise A Jour No 2-3T №v)- |БŽд=P„№Dispositifs antichutes, cordes d´assurance verticales et guides-Premiere Edition; Fiche No 1; Mise A Jour No 2-3T№v+1 |Б?д=P„№Dispositifs antichutes, cordes d´assurance verticales et guides-Premiere Edition; Fiche No 1; Mise A Jour No 2-3T№v-5 |Б?д=P„№Dispositifs antichutes, cordes d´assurance verticales et guides-Premiere Edition; Fiche No 1; Mise A Jour No 2-3T№v/; |Б?д=P„№Dispositifs antichutes, cordes d´assurance verticales et guides-Premiere Edition; Fiche No 1; Mise A Jour No 2-3T№v1? |Б?д=P„№Dispositifs antichutes, cordes d´assurance verticales et guides-Premiere Edition; Fiche No 1; Mise A Jour No 2-3T№v3C |Б?д=P„№Dispositifs antichutes, cmrdes d´assurance verticales et guides-Premiere Edition; Fiche No 1; Mise A Jour No 2-3T№v5E |Б?д=P„№Dispositifs antichutes, cordes d´assurance verticales et guides-Premiere Edition; Fiche No 1; Mise A Jour No 2-3T№v7G |Б?д=P„№Dispositifs antichutes, cordes d´assurance verticales et guides-Premiere Edition; Fiche No 1; Mise A Jour No 2-3T№v9I |Б?д=P„№Dispositifs antichutes, cordes d´assurance verticales et guides-Premiere Edition; Fiche No 1; Mise A Jour No 2-3T№v;M |Бд=P„№Dispositifs antichutes, cordes d´assurance verticales et guides-Premiere Edition; Fiche No 1; Mise A Jour No 2-3T№v=Q |Бд=P„№Dispositifs antichutes, cordes d´assurance verticales et guides-Premiere Edition; Fiche No 1; Mise A Jour No 2-3T№v?U |Бд=P˜№General Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T№ŠAY |Б?д=PQ№ISO 9001 for Small Businesses!- What to do - Advice from ISO/TC 176T№CC] |Бд=Pk№General Requirements for the Competence of Testing and Calibration Laboratories-First EditionT№]Ea |Б?д=P№k№General Requirements for the Competence of Testing and Calibration Laboratories-First EditionT№]Gc |Бд=PC] |Бд=P№k№General Requirements for the Competence of Testing and Calibration Laboratories-First EditionT№]Ea |Б?д=Pœ„oЩŒ– TXh€joxzBNTTFBAAAAAAAAAARP-7/яt)HCIESNAACTV-CURRENБFфy%д€ш”М8ф` ˆ4А\и„Ќ(дPќx$ LШt№œЭyљ Ѕ Q С m  O ћ 1 н ‰ 5 ФpџЋ6тJі9ъ–%бv"ЧsФiД`џ?˜йцЊ‘+\Т]№Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000T№O‘‘g‘ ‘|БŽд=P‰№Medical devices Quality management systems Guidance on the application of ISO 13485:2003-First Edition; ISO/TR 14969:2004T№{‘‘l‘ ‘|Бд=Pw№Medical Devices - Application of Risk Management to Medical Devices-First Edition; Amendment 1: 3/01/2003T№i‘‘n‘ ‘|Бд=PT №;INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-10th Edition№б@№DiamlerChrysler, Ford, and General Motors Supplier Quality Requirements QS 7 Pack **** Includes AIAG Manuals QS-9000, QSA, APQP, MSA, SPC, PPAP and FMEA-Hardcopy Available from Global EngineeringT@№У‘‘а‘ ‘|БЃд=P’A№Software engineering Guidelines for the application of ISO 9001:2000 to computer software-First Edition; (Replaces ISO 9000-3:1997)TA№„‘ ‘д‘ ‘|Бд=PhB№Specification for Fusion Welding for Aerospace Applications-Incorporating Errata - 07/2001TB№Z‘ ‘й‘ ‘|Бд=PhC№Specification for Fusion Welding for Aerospace Applications-Incorporating Errata - 07/2001TC№Z‘ ‘л‘ ‘|Бд=PhD№Specification for Fusion Welding for Aerospace Applications-Incorporating Errata - 07/2001TD№Z‘‘н‘ ‘|Бд=PhE№Specification for Fusion Welding for Aerospace Applications-Incorporating Errata - 07/2001TE№Z‘‘у‘ ‘|БЃд=P{F№Canadian Electrical Code Part I; Safety Standard for Electrical Installations-Nineteenth Edition; Update No 1TF№m‘‘ч‘ ‘|Б^д=P{G№Canadian Electrical Code Part I; Safety Standard for Electrical Installations-Nineteenth Edition; Update No 1TG№m‘‘э‘ ‘|Бд=P‹H№Regional Supplementary Procedures-Fourth Edition; Incorporating Amds 1-182;!Reprinted 04/95; Includes Amd 183 Thru Amd 185: 1996; Amd 186 Thru Amd 191:1999; Amd 192 Thru Amd 193: 1998; Corrigendum 1: 1999; Amd 194 Thru Amd 200: 2000; Amd 201 Thru Amd 202: 2001; Amd 202: 2001; Amd 203 Thru Amd 204: 2002; ; Amd 205 Thru Amd 206: 2003; Corrigendum 2: 2004; Amd 207 and Amd 208: 2004TH№}‘‘ђ‘ ‘|Б^д=P‹I№Regional Supplementary Procedures-Fourth Edition; Incorporating Amds 1-182; Reprinted 04/95; Includes Amd 181 Thru Amd 185: 1996; Amd 186 Thru Amd 191:1999; Amd 192 Thru Amd 193: 1998; Corrigendum 1: 1999; Amd 194 Thru Amd 200: 2000; Amd 201 Thru Amd 202: 2001; Amd 202: 2001; Amd 203 Thru Amd 204: 2002; ; Amd 205 Thru Amd 206: 2003; Corrigendum 2: 2004; Amd 207 and Amd 208: 2004TI№}‘‘є‘ ‘|Бд=P‹J№Regional Supplementary Procedures-Fourth Edition; Incorporating Amds 1-182; Reprinted 04/95; Includes Amd 183 Thru Amd 185: 1996; Amd 186 Thru Amd 191:1999; Amd 192 Thru Amd 193: 1998; Corrigendum 1: 1999; Amd 194 Thru Amd 200: 2000; Amd 201 Thru Amd 202: 2001; Amd 202: 2001; Amd 203 Thru Amd 204: 2002; ; Amd 205 Thru Amd 206: 2003; Corrigendum 2: 2004; Amd 207 and Amd 208: 2004TJ№}‘‘њ‘ ‘|БЃд=P‹K№Regional Supplementary Procedures-Fourth Edition; Incorporating Amds 1-182; Reprinted 04/95; Includes Amd 183 Thru Amd 185: 1996; Amd 186 Thru Amd 191:1999; Amd 192 Thru Amd 193: 1998; Corrigendum 1: 1999; Amd 194 Thru Amd 200: 2000; Amd 201 Thru Amd 202: 2001; Amd 202: 2001; Amd 203 Thru Amd 204: 2002; ; Amd 205 Thru Amd 206: 2003; Corrigendum 2: 2004; Amd 207 and Amd 208: 2004TK№}‘‘ќ‘ ‘|БЏд=PxL№Measurement Systems Analysis (MSA)-3rd Edition; Hardcopy Available from Global Engineering; Reprint 5/2003TL№j‘‘‘ ‘|Б^д=PбM№Noneerrous Metals-Nickel, Cobalt, Lead, Tin, Zinc, Cadmium, Precious, Reactive, Refractory Metals and Alloys; Materials for Thermostats, Electrical Heating and Resistance Contacts, and ConnectorsTM№У‘!‘ ‘ ‘|Б^д=P˜N№General Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TN№Š‘#‘ ‘ ‘|Б^д=P TO№9Electronic Equipment Used on Rail Vehicles-Second EditionЉ@TP№$Freight containers Mechanical seals‡žQ0ВКЉ@АTQ№$Freight containers Mechanical seals‡žQ0ВКЉ@АTR№$Freight containers Mechanical seals‡žQ0ВКЉ@АѓS№Blood Grouping and Anti-Human Globulin Reagents (Supersedes CAN/CGSB- 106.1-M86, CAN/CGSB-106.2-M91, CAN/CGSB-106.3-M86, CAN/CGSB-106.4-M86)-Supersedes CAN/CGSB 116.1-M86, CAN/CGSB-106.2-M91, CANCGSB-106.3-M86, CAN/CGSB-106.4-M86aV№Environmental management systems Requirements with guidance for use-Second EditionTV№S‘*‘6‘ ‘|Б?д=PaW№Environmental management systems Requirements with guidance for use-Second EditionTW№S‘,‘:‘ ‘|БŽд=PaX№Environmental management systems Requirements with guidance for use-Qecond EditionTX№S‘.‘>‘ ‘|БŽд=PaY№Environmental management systems Requirements with guidance for use-Second EditionTY№S‘0‘B‘ ‘|Б?д=PaZ№Environmental management systems Requirements with guidance for use-Second EditionTZ№S‘2‘F‘ ‘|Бд=Pa[№Environmental management systems Requirements with guidance for use-Second EditionT[№S‘4‘J‘ ‘|Б?д=P€\№Insert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340T\№r‘6‘O‘ ‘|Б?д=P€]№Insert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340T]№r‘8‘Q‘ ‘|Б?д=P]^№Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000T^№O‘:‘W‘ ‘|Бд=Pi_№Information Technology - Code of Practice For Information Security Management-First EditionT_№[‘<‘]‘ ‘|Б?д=Pщ§щ§Information Technology - Coding of Moving Pictures and Associated Audio for Digital Storage Media at up to About 1,5 Mbit/s - Part 1: Systems-First Edition; CEN EN ISO/IEC 11172-1: 1995; AS/NZS 4230.1: 1994; Corrigendum 1: 1996; Corrigendum 2: 1999urity Management-First EditionT_№[‘<‘]‘ ‘|Б?д=P@ ™Р €HpяЈEР ƒHџџџџџџяHћЈE@ ™Р €HИяЈEџџџџџџяЄBй…(дT€,ЫwТa ЌXїЃBOћЇSџЋПюš"ЮCяd  … 1 І R зƒДLј<д€Ф2о ЙeюšН`џG˜йжЊ’МСт!№Geometrical Product Specifications (GPS) - Standard Reference Temperature for Geometrical Product Specification and Verification-Second EditionT!№’’x’ ’|БNд=P"№Geometrical Product Specifications (GPS) - Standard Reference Temperature for Geometrical Product Specification and Verification-Second EditionT"№’’{’ ’|БNд=P#№Geometrical Product Specifications (GPS) - Standard Reference Temperature for Geometrical Product Specification and Verification-Second EditionT#№’’}’ ’|БNд=PT$№9Passenger Car Tyres and Rims - Part 2: Rims-Third Edition^%№Shipbuilding - Inland Navigation - Raft-Type Life-Saving Apparatus First EditionT%№P’’Ž’ ’|БЃд=P˜&№General Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T&№Š’ ’“’ ’|Бд=P˜'№General Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T'№Š’ ’—’ ’|БЃд=P„(№Council Directive on the Approximation of the Laws of the Member States Relating to the Engine Power of Motor VehiclesT(№v’ ’›’ ’|Б^д=Pѓ)№Electrical Apparatus for Explosive Gas Atmosphere Set ***Contains 60079-0, -1, -1-1, -2, -4, -5, -6, -7, -10, -11, -14, -15, -17, -18, -19, IEC/TR 60079-12, IEC/TR 60079-13, IEC/TR 60079-16, IEC/TR 60079-20 and IEC/TS 60079-27***T)№х’’І’ ’|БЃд=P”*№Electrical apparatus for explosive gas atmospheres Part 25: Intrinsically safe systems-(IEC 60079-25:2003) (Supersedes EN 50039:1980)T*№†’’Ј’ ’|Б^д=Pf+№Quality management systems Guidelines for quality management in projects-Second EditionT+№X’’Ќ’ ’|БЃд=Pq,№Quality Management Systems - Reruirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T,№c’’Ў’ ’|БЃд=P’-№Software engineering Guidelines for the application of ISO 9001:2000 to computer software-First Edition; (Replaces ISO 9000-3:1997)T-№„’’А’ ’|Б^д=Pd.№Standard Classification System for Rubber Products in Automotive Applications-SAE J200T.№V’’Д’ ’|БЃд=PTS№х‘)’’ ’|Бiд=PTщ§ј‘>’f’ ’|Бд=PXћ§Binary Floating-Point Arithmetic for Microprocessor Systems Second EditionTћ§J’’’ ’|Б д=PTќ§ Tile, CeramicВ—G0 QF hЧEXЧEtВЧE,Г‡™Gа(QFT§§ Tile, CeramicВ—G0 QF hЧEXЧEtВЧE,Г‡™Gа(QFTў§<Structural Welding Code Aluminum-Fourth Edition; Errata:2004P]FTџ§.Metric Practice Guide for the Welding Industryn; Errata:2004P]FЉўPower Converters Installed on Board Rolling Stock Part 1: Characteristics and Test Methods-First Edition; Supersedes IEC 411, 411-1, 411-3, 411-4 and 411-5Tў›’#’—’ ’|Б д=P~ўPower Converters Installed nn Board Railway Rolling Stock Part 2: Additional Technical Information-First EditionTўp’%’™’ ’|Б д=P‡ўMedical devices - Application of risk management to medical devices (ISO 14971:2000); English version of DIN EN ISO 14971Tўy’'’ž’ ’|Бд=PЉўPower Converters Installed on Board Rolling Stock Part 1: Characteristics and Test Methods-First Edition; Supersedes IEC 411, 411-1, 411-3, 411-4 and 411-5Tў›’)’Њ’ ’|БИд=PЉўPower Converters Installed on Board Rolling Stock Part 1: Characteristics and Test Methods-First Edition; Supersedes IEC 411, 411-1, 411-3, 411-4 and 411-5Tў›’+’­’ ’|БАд=P~ўPower Converters Installed on Board Railway Rolling Stock Part 2: Additional Technical Information-First EditionTўp’-’Џ’ ’|БАд=PšўDegrees of Protection Provided by Enclosures (IP Code)-Edition 2.1; Edition 2:1989 Consolidated with Amendment 1:1999; Corrigendum 1: 1/2003TўŒ’/’Д’ ’|Б д=PšўDegrees of Protection Provided by Enclosures (IP Code)-Edition 2.1; Edition 2:1989 Consolidated with Amendment 1:1999; Corrigendum 1: 1/2003TўŒ’1’Ж’ ’|Б д=PšўDegrees of Protection Provided by Enclosures (IP Code)-Edition 2.1; Edition 2:1989 Consolidated with Amendment 1:1999; Corrigendum 1: 1/2003TўŒ’3’И’ ’|Б д=Pq ўQuality management systems Guidelines for configuration management-Second Edition; ISO 10007: 2003T ўc’5’М’ ’|Б˜д=Pm ўInformation Technolngy - Software Life Cycle Processes - Configuration Management-First EditionT ў_’7’О’ ’|Б д=Pˆ ўConcrete Materials and Methods of Concrete Construction/ Methods of Test and Standard Practices for Concrete-Tenth EditionT ўz’9’Т’ ’|Б д=PT ў7Minimum Design Loads for Buildings and Other Structuresa ўEnvironmental management systems Requirements with guidance for use-Second EditionT ўS’<’Ъ’ ’|Б д=PjўBuilding Code Requirements for Structural Concrete (ACI 318-05) and Commentary (ACI 318R-05)Tў\’>’Ь’ ’|Бд=PTў7Minimum Design Loads for Buildings and Other StructuresКЉ@ШTў7Minimum Design Loads for Buildings and Other StructuresўElectronagnetic Compatibility (EMC) - Part 4-1: Testing and Measurement Techniques - Overview of IEC 61000-4 Series-Second EditionTў‚’B’л’ ’|Б д=PКўElectromagnetic compatibility (EMC) - Part 4-11: Testing and measurement techniques - Voltage dips, short interruptions and voltage variations immunity tests-Second EditionTўЌ’D’н’ ’|Б д=PўРўElectronagnetic Compatibility (EMC) Part 4-12: Testing and Measurement Techniques - Oscillatory Waves Immunity Test-Edition 1.1; Edition 1:1995 Consolidated with Amendment 1:2000nd measurement techniques - Voltage dips, short interruptions and voltage variations immunity tests-Second EditionTўЌ’D’н’ ’|Б д=PъˆЮzъ–Bю„0Я{'ŸKоŠХ+з=щOћ})€,ƒ/ЈTж‚й…1н ‰ 5 н ‰ 5 с } ) — C в ~  Ф0мщ•Н%б9х‡3пBюQ§`џA˜йQ;“у@?3†T№Medical Devices - Risk Management - Part 1: Application of Risk Analysis-Edition 1; Identical to ISO 14971-1; AMD 1:2003TT№x““#“ “|БVд=P˜U№General Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TU№Š““(“ “|БЗд=PTўВ’F“п“ “|Бд=PгўElectromagnetic Compatibility (EMC) - Part 4-2: Testing and Measurement Techniques - Electrostatic Discharge Immunity Test-Edition 1.2; Edition 1:1995 Consolidated with Amendments 1:1998 and 2:2000TўХ““с“ “|Бд=PрўElectromagnetic Compatibility (EMC) - Part 4-3: Testing and Measurement Techniques - Radiated, Radio-Frequency, Electromagnetic Field Immunity Test-Edition 2.1; Edition 2:2002 Consolidated with Amendment 1:2002Tўв““у“ “|Бд=PŸўElectromagnetic compatibility (EMC) Part 4-4: Testing and measurement techniques Electrical fast transient/burst immunity test-Second EditionTў‘“ “х“ “|Бд=PЕўElectromagnetic Compatibility (EMC) - Paru 4-5: Testing and Measurement Techniques - Surge Immunity Test-Edition 1.1; Edition 1:1995 Consolidated with Amendment 1:2000TўЇ“ “ч“ “|Бд=PчўElectromagnetic compatibility (EMC) Part 4-6: Testing and measurement techniques Immunity to conducted disturbances, induced by radio-frequency fields-Edition 2.1; Edition 2:2003 Consolidated with Amendment 1:2004Tўй“ “ш“ “|Бд=PаўElectromagnetic Compatibility (EMC) - Part 4-8: Testing and Measurement Techniques - Power Frequency Magnetic Field Immunity Test-Edition 1.1; Edition 1: 1993 Consolidated with Amendment 1: 2000TўТ““ъ“ “|Бд=PўElectromagnetic Compatibility (EMC) - Part 4-1: Testing and Measurement Techniques - Overview of IEC 61000-4 Series-Second EditionTў‚““э“ “|БИд=PўElectromagnetic Compatibility (EMC) - Part 4-1: Testing and Measurement Techniques - Overview of IEC 61000-4 Series-Second EditionTў‚““ё“ “|Б д=PўElectromagnetic Compatibility (EMC) - Part 4-1: Testing and Measurement Techniques - Overview of IEC 61000-4 Series-Second EditionTў‚““ѓ“ “|Б д=PКўElectromagnetic compauibility (EMC) - Part 4-11: Testing and measurement techniques - Voltage dips, short interruptions and voltage variations immunity tests-Second EditionTўЌ““ѕ“ “|Б˜д=PРўElectromagnetic Compatibility (EMC) Part 4-12: Testing and Measurement Techniques - Oscillatory Waves Immunity Test-Edition 1.1; Edition 1:1995 Consolidated with Amendment 1:2000TўВ““ї“ “|Б˜д=PгўElectromagnetic Compatibility (EMC) - Part 4-2: Testing and Measurement Techniques - Electrostatic Discharge Immunity Test-Edition 1.2; Edition 1:1995 Consolidated with Amendments 1:1998 and 2:2000TўХ““ј“ “|Б˜д=Pр ўElectromagnetic Compatibility (EMC) - Part 4-3: Testing and Measurement Techniques - Radiated, Radio-Frequency, Electromagnetic Field Immunity Test-Edition 2.1; Edition 2:2002 Consolidated with Amendment 1:2002T ўв““њ“ “|Б˜д=PŸ!ўElectromagnetic compatibility (EMC) Part 4-4: Testing and measurement techniques Electrical fast transient/burst immunity test-Second EditionT!ў‘““ќ“ “|Б˜д=PT6ў,Recommended Practices for Resistance WeldingДH,ГИ‡™GаhEFa7ўEnvironmental management systems Requirements with guidance for use-Second EditimnT7ўS“"“2 “ “|БАд=Pj8ўISO 9000 COLLECTION 1 FRENCH-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004T8ў\“$“8 “ “|Бд=Pz9ўConformity assessment General requirements for bodies operating certification of persons-ISO/IEC 17024: 2003T9ўl“&“< “ “|БИд=Po:ўStandard Guide fmr Environmental Site Assessments: Phase II Environmental Site Assessment ProcessT:ўa“(“D “ “|БИд=PІ;ўInformation Technology - Telecommunications and Information Exchange between Systems - High-Level Data Link Control (HDLC) Procedures-ISO/IEC 13239:2002T;ў˜“*“M “ “|Б д=P€<ўAcoustics - Attenuation of Sound During Propagation Outdoors - Part 2: General Methmd of Calculation-First EditionT<ўr“,“W “ “|Б д=PQ=ўFerronickel - Specification and Delivery Requirements First EditionT=ўC“.“[ “ “|Бд=PT>ў@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176T?ў@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176T@ў@ISO 9001 For Small Business - What To Do - Aevice From ISO/TC176TAў@Laboratory Glassware - One-Mark Volumetric Flasks-Fourth EditioncBўISO 9000 COLLECTION 1-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004TBўU“4“l “ “|Б˜д=P™CўCLEANROOMS AND ASSOCIATED CONTROLLED ENVIRONMENTS SET-INCLUDES: ISO 14644-1, ISO 14644-2, ISO DIS 14644-3, ISO 14644-4, AND ISO DIS 14644-5TCў‹“6“p “ ‘|Б˜д=P{DўCleanrooms and Associated Controlled Environments Part 4: Design, Construction and Start-Up-ISO 14644-4: 2001TDўm“8“r “ “|Б д=P˜XўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TXўŠ“:“б “ “|БЈд=P˜jўGeneral Requirements for the Competence of Uesting and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TjўŠ“<“ю “ “|Б д=PkўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Supersedes ISO/IEC Guide 25 FrenchTkў“>“№ “ “|Б д=P•ў˜•ўGeneral Requirements for the Competence of Testing and Calibration Laboratorieq-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990kўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Supersedes ISO/IEC Guide 25 FrenchTkў“>“№ “ “|Б д=PˆyMˆyMyMp„M`gMЃAВ^Цrк† ЗЪgПkУržJЄPсПU LјY%бў Њ ъ – м ˆ ј Є  Р 0 м Иб}ШtеЁMz&в:ц`џD˜йX<”ŽС@"ўMedical devices Quality management systems Guidance on the application of ISO 13485:2003-First Edition; Replaces ISO 14969:1999T"ў”” ” ”|Бљд=P€#ўAcoustics - Attenuation of Sound During Propagation Outdoors - Part 2: General Method of Calculation-First EditionT#ўr”” ” ”|Бёд=P€$ўAcoustics - Attenuation of Sound During Propagation Outdoors - Part 2: General Method of Calculation-First EditionT$ўr”” ” ”|Бёд=P˜EўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TEўŠ””| ” ”|Бюд=P˜lўGeneral Requirements for tie Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TlўŠ””є ” ”|Бд=PT•ўŠ“@”e ” ”|БЈд=P–ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Supersedes ISO/IEC Guide 25 FrenchT–ў” ”g ” ”|БЈд=P—ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Supersedes ISO/IEC Guide 25 FrenchT—ў” ”i ” ”|Бд=P˜˜ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T˜ўŠ””k ” ”|БЈд=P˜™ўGeneral Requirements for the Competence mf Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T™ўŠ””m ” ”|Бд=PšўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Supersedes ISO/IEC Guide 25 FrenchTšў””o ” ”|Бд=P›ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Ediuion; Supersedes ISO/IEC Guide 25 FrenchT›ў””q ” ”|БЈд=PœўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Supersedes ISO/IEC Guide 25 FrenchTœў””s ” ”|Бд=P˜ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TўŠ””u ” ”|БЈд=P‹žўSI Units and Recommendations for the Use of Their Multiples and of Certain Other Units-Third Edition; Amendment 1: 11-01-1998Tžў}””w ” ”|Б~д=P˜ЂўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TЂўŠ””‹ ” ”|Бід=P˜ЃўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TЃўŠ””‘ ” ”|Бід=PQаўGuidance on statistical techniques for ISO 9001:2000-Second EditionTаўC”!” ” ”|Бд=PyбўCentrifugal Pumps for Petroleum, Petrochemical and Natural Gas Industries-Tenth Edition; ISO 13709 AdoptionTбўk”#” ” ”|Б˜д=P_вўElectrical apparatus for potentially explosive atmospheres - Intrinsic safety "i"TвўQ”%” ” ”|Б д=PэгўGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, Durability, and Performance Requirememts-Engl; Revision CTгўп”'” ” ”|Б д=P˜дўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TдўŠ”)” ” ”|Б˜д=P˜еўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TеўŠ”+” ” ”|Б˜д=PrжўFall Arresters, Vertical Lifelines, and Rails-First Edition; General Instruction No 1; Update No 2-4Tжўd”-” ” ”|БАд=P˜зўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990Tиў@Software Engineering Software Measurement Process-First Edition_йўElectrical apparatus for potentially explosive atmospheres - Intrinsic safety "i"TйўQ”1”+ ” ”|БИд=PcкўGuidelines for Quality and/or Environmental Management Systems Auditing-First EditionTкўU”3”2 ” ”|Бћд=PcлўGuidelines for Quality and/or Environmental Management Systems Auditing-First EditionTлўU”5”4 ” ”|Бћд=PжмўGuidelines for Quality and/or Environmental Management Systems Auditing-First Edition; Replaces ISO 10011-1:1990, ISO 10011-2:1991, ISO 10011-3:1991, ISO 14010:1996, ISO 14011:1996, and ISO 14012:1996TмўШ”7”6 ” ”|Бћд=PжнўGuidelines for Quality and/or Environmental Management Systems Auditing-First Edition; Replaces ISO 10011-1:1990, ISO 10011-2:1991, ISO 10011-3:1991, ISO 14010:1996, ISO 14011:1996,!and ISO 14012:1996TнўШ”9”8 ” ”|Бћд=PT‰ "A DESIGNER´S HANDBOOK-SP1118,CX,CtВ5,C,Г5‡™Gа(CTŠ /Geographic Information - Metadata-First EditionDpŽPDрkFD4В5КЉ@ˆ‹ Concrete Materials and Methods of Concrete Construction/ Methods of Test and Standard Practices for Concrete-Tenth EditionT‹ z”=”I ” ”|Б,д=P˜Œ General!Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TŒ Š”?”M ” ”|Б,д=PЋ {Ћ Information Technology Equipment - Safety - Part 1: General Requirements-First Edition; Corrigendum 1:10-2002TЋ m”A”” ” ”|Б,д=PЌ {Ќ Information Technology Equipment - Safety - Part!1: General Requirements-First Edition; Corrigendum 1:10-2002S COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISO 14001, 14004, 14010, 14011, 14012, DIS 14015, 14020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041, 14042, 14043, TR 14049, 14050, AND TR 14061; SEE ALSO ISO 14000 SERIES AND CD HC\GProС_ф‚ъ–Кf<шО[ЄPёБ?ыSџg&вsІR­С ) е J і ^ { ' ˜ D ЕaЩuн‰њІУoзƒы—УCя`џN˜й?O•нAС‚FўSoftware Engineering - Product Quality - Part 1: Quality Model-First Edition; Cancels and Replaces ISO/IEC 9126:1991TFўt••… • •|Бљд=P]GўSoftware Engineering - Product Quality - Part 2: External Metrics-First EditionTGўO••ˆ • •|Бљд=P]HўSoftware Engineering - Product Quality - Part 3: Internal Metrics-First EditionTHўO••Š • •|Бљд=PaIўSoftware engineering Product quality Part 4: Quality in use metrics-First EditionTIўS••Œ • •|Бљд=PЂJўElectrical Equipment for Measurement, Control and Laboratory Use - EMC Requirements-Includes Amendments A1:1998, A2:2001 and A3:2003; IEC 61326:2002TJў”••” • •|БЮд=PРKўInformation technology equipment Immunity characteristics Limits and methods of measurement-Includes amendments A1:2001 and A2:2003; CISPR 24:1997 + A1:2001 + A2:2002, modifiedTKўВ• •– • •|БЮд=PPLўSafety of Machinery - Principles of Risk Assessment-ISO 14121:1999TLўB• • • •|Бід=PcMўGuidelines for Quality and/or Environmental Management Systems Auditing-First EditionTMўU••Ё • •|Бід=PTNў(Basic Tolerances for Building Components0 I0 Id ITOў(Basic Tolerances for Building ComponentspfI0ВЮКЉ@PTPў&Emergency Eyewash and Shower EquipmentјFЬH0ВіКЉ@ШaQўSteel for the Prestressing of Concrete - Part 1: General Requiremenvs First EditionTQўS••Е • •|Бљд=P\RўSteel for the Prestressing of Concrete - Part 2: Cold-Drawn Wire First EditionTRўN••З • •|Бљд=PgSўSteel for the Prestressing of Concrete - Part 3: Quenched and Tempered Wire First EditionTSўY••Й • •|Бљд=P}TўSteel for the Prestressing of Concrfte - Part 4: Strand-First Edition; Corrigendum 1: 1992; Corrigendum 2: 2000TTўo••Л • •|Бљд=PˆUўSteel for the Prestressing of Concrete - Part 5: Hot-Rolled Steel Bars with or without Subsequent Processing First EditionTUўz••Н • •|Бёд=PaVўSteel for the Prestressing of Concrete - Part 1: General Requirements First EditionTVўS••П • •|Бљд=PTWў;Motion-Picture Film (16-mm) - 100-Mil Magnetic Audio RecordP˜ЄўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TЄўŠ• •— • •|БFд=P˜ЅўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide"25: 1990TЅўŠ•"•™ • •|БFд=P˜ІўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TІўŠ•$•› • •|БFд=PЇўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Supersedes ISO/IEC Guide 25 FrenchTЇў•&– • •|БFд=P˜ЈўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TЈўŠ•(•Ÿ • •|БFд=PT Sodium Chloride NaCl FW:58.44h”:DX†:DtВ,”:D,Г,‡™Gа(ŠDT‘ 5Cold-Reduced Carbon Steel Sheets and Strip; Edition 1ВnD4В5КЉ@T’ Hydrochloric Acidon Steel Sheets and Strip; Fdition 1ВnD4В5КЉ@T“ Sodium Hydroxidedon Steel Sheets and Strip; Edition 1ВnD4В5КЉ@T” Hexamethylenetetramineeel Sheets and Strip; Edition 1ВnD4В5КЉ@T• 4Methods for Determination of pH of Aqueous Solutions1ВnD4В5КЉ@S– Standard Symbols for Welding, Brazing, and Nondestructive ExaminationT– E•0•j • •|Б5д=PS— Standard Symbols for Welding, Brazing, and Nondestructive EzaminationT— E•2•o • •|Б5д=PS˜ Standard Symbols for Welding, Brazing, and Nondestructive ExaminationT˜ E•4•s • •|Б5д=Pp™ Methodes D´Essai Des Peintures Et Pigments Facilite De Nettoyage Essai De La Tache De BitumeT™ b•6•w • •|Б,д=PTЌ m”C•˜ • •|Б,д=P‚Ў Respiratory Equipment - Open-Circuit Self-Contained Compressed Air Diving Apparatus - Requirements, Testing, MarkingTЎ t•9•Ё • •|Б5д=PaЏ Environmental management systems Requirements with guidance for use-Second EditionTЏ S•;•Љ • •|Б,д=PdА Belt Drives - V-Belts and V-Ribbed Belts - Calculation of Power Ratings Sebond EditionTА V•=•А • •|Б,д=P—Б Electrical Apparatus for Explosive Gas Atmospheres Part 16: Artificial Ventilation for the Protection of Analyzer(s) Houses-First EditionTБ ‰•?•Ж • •|Б5д=P—В Electrical Apparatus for Explosive Gas Atmospheres Part 16: Artificial Ventilation for the Protection of Analyzer(s) Houses-First EditionTВ ‰•A•И • •|Б,д=PaГ Environmental management systems Requirements with guidance for use-Second EditionTГ S•C•М • •|Б,д=PlД ISO 9000 Essentials a Practical Handbook for Implementing the ISO 9000 Standards-Third EditionTД ^•E•Р • •|БYд=PbЕ Software engineeringProduct quality Part 2: External metrics-ISO/IEC TR"9126-2: 2003TЕ T•G•Ф • •|БYд=PЖ [Ж Software engineeringProduct quality Part 1: Quality model-ISO/IEC 9126-1:2001TЖ M•I•Ц • •|БYд=PЗ aЗ Environmental management systems Requirements with guidance for use-Second EditionTЗ S•K•Ь • •|БYд=PИ aИ Envjronmental management systems Requirements with guidance for use-Second Editionplementing the ISO 9000 Standards-Third EditionTД ^•E•Р • •|БYд=PЕ bЕ Software engineeringProduct quality Part 2: External metrics-ISO/IEC TR 9126-2: 2003`bsHюŒ+Щn ЊVъ–5сJі_ ЇSђžШtА] ЖbЛgПkУ+зHє\p  „ 0 м { ' Ÿ K Ю z  ПcЎZВ^ћЇWCяMљ˜Dч“6т`џB˜йJ@–­2mўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Supersedes ISO/IEC Guide 25 FrenchTmў––і – –|Бд=PnўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Supersedes ISO/IEC Guide 25 FrenchTnў––љ – –|Бд=P˜oўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990ToўŠ––ћ – –|Б˜д=P˜pўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TpўŠ––џ – –|Б д=PqўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Supersedes ISO/IEC Guide 25 FrenchTqў–– – –|Б д=PrўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Supersedes ISO/IEC Guide 25 FrenchTrў– – – –|Б д=P˜sўGeneral Requirements for the Competence of Terting and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TsўŠ– – – –|Б˜д=PtўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Supersedes ISO/IEC Guide 25 FrenchTtў–– – –|Б˜д=P˜uўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition;"Cancels and Replaces ISO/IEC Guide 25: 1990TuўŠ–– – –|Б д=P˜vўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TvўŠ–– – –|Б д=P˜wўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 2990TwўŠ–– – –|Б д=P˜xўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TxўŠ–– – –|Бд=PyўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Supersedes ISO/IEC Guide 25 FrenchTyў–– – –|Бд=P˜zўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TzўŠ–– – –|Бд=P˜{ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T{ўŠ–– – –|Б˜д=P|ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Supersedes ISO/IEC Guide 25 FrenchT|ў–– – –|Б˜д=P˜}ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T}ўŠ– – – –|Б˜д=P~ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Supersedes ISO/IEC Guide 25 FrenchT~ў–"– – –|Б˜д=P˜ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TўŠ–$– – –|Б˜д=P€ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First"Edition; Supersedes ISO/IEC Guide 25 FrenchT€ў–&– – –|Б˜д=P˜ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TўŠ–(– – –|Б˜д=P˜‚ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 2990T‚ўŠ–*– – –|Б˜д=P˜ƒўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TƒўŠ–,–" – –|Б˜д=P„ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Supersedes ISO/IEC Guide 25 FrenchT„ў–.–# – –|Б˜д=P˜…ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T…ўŠ–0–% – –|БИд=P˜†ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T†ўŠ–2–' – –|БИд=P˜‡ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T‡ўŠ–4–( – –|БИд=P˜ˆўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TˆўŠ–6–, – –|БИд=P˜‰ўGeneral Requirements for thf Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T‰ўŠ–8–. – –|Б д=P˜ŠўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TŠўŠ–:–0 – –|Б д=P˜‹ўGeneral Requirements for the Competence of Testing and Calibration Naboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T‹ўŠ–<–2 – –|Бод=PUŒўQuality Management Systems - Fundamentals and Vocabulary-Second EditionTŒўG–>–7 – –|Бд=PTў;INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-10th EditionŽў›ŽўAcoustics - Attenuation of Sound During Propagation Outdoors - Part 1: Calcunation of the Absorption of Sound by the Atmosphere First EditionŒўUŒўQuality Management Systems - Fundamentals and Vocabulary-Second EditionTŒўG–>–7 – –|Бд=PTў;INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-10th Edition0рvI`ЉЙIxU4HЅCяšFЎZТnж‚ъ–ўЊО&вCяWk+œHА\Эyсў Њ  О & в C я W  k  +“?А\ФpсўЊО&вCя`џM˜й^—ЁTŽў–A= — —|БЈд=P€ўAcoustics - Attenuation of Sound During Propagation Outdoors - Part 2: General Method of Calculation-First EditionTўr——@ — —|Бд=PaўEnvironmental management systems Requirements with guidance for use-Second EditionTўS——J — —|Бд=PT‘ў>Requirements for Soldered Electrical and Electronic Assemblies`’ўSafety Code on Mobile Cranes-General Instruction No 1; Update No 2; Second EditionT’ўR——U — —|Бд=PT“ў9Specification for Welding of Presses and Press ComponentsЉ@PT”ў;INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-10th EditionWуxTЉў Power PipingВ~—G0ЧE hєБIXцБItВ~єБI,Г~‡™GаЧEVЊўNAS Certification & Qualification of Nondestructive Test Personnel-REV 2TЊўH— —Ј — —|БЈд=PVЋўNAS Certification & Qualification of Nondestructive Test Personnel-REV 2TЋўH— —Њ — —|Бд=PTЌў@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176˜­ўGeneral Qequirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T­ўŠ——Ж — —|Бд=P˜ЎўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TЎўŠ——Й — —|Б~д=P˜ЏўGeneral Requirements for the Competence of Testimg and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TЏўŠ——Л — —|Бд=PTАў-Battery Chargers-Second Edition; Update No. 1`…H0`…Hd`…HTБў-Battery Chargers-Second Edition; Update No. 1 C0 Cd CЖВўModerate Thermal Environments - Determination of the PMV and PPD Indices and Specification of the Conditions for Thermal Comfort Second Edition; (CEN EN ISO!7730: 1995)TВўЈ——Х — —|БЈд=PZГўStandard Practice for Maintenance Procedures for Amusement Rides and DevicesTГўL——Щ — —|БЈд=PZДўStandard Practice for Maintenance Procedures for Amusement Rides and DevicesTДўL——а — —|БЈд=PZЕўStandard Practice for Maintenance Procedures for Amusement Rides and DevicesTЕўL——в — —|БЈд=PZЖўStandard Practice for Maintenance Procedures for Amusement Rides and DevicesTЖўL— —г — —|БЈд=PZЗўStandard Practice for Maintenance Procedures for Amusement Rides and DevicesTЗўL—"—д — —|БЈд=PƒИўStandard Practice for Amusement Ride and Device Manufacturer Quality Assurance Program and Manufacturing RequirementsTИўu—$—з — —|Бд=PƒЙўStandard Practice for Amusement Ride and Device Manufacturer Quality Assurance Program and Manufacturing RequirementsTЙўu—&—й — —|Бд=PXКўStandard Practice for Operation Procedures for Amusement Rides and DevicesTКўJ—(—н — —|Бд=PфЛўNatural Gas - Calculation of Calorific Values, Density, and Relative Density and Wobbe Index from Composition-Second Edition; Corrected and Reprinted 02/01/1996; Corrigendum 2: 12/15/1997; Corrigendum 3: 08/01/1999TЛўж—*—т — —|Бд=PTМў9Natural Gas - Standard Reference Conditions-First EditionЉ@иiНўRefrigerated Hydrocarbon Liquids - Static Measurement - Calculation Prmcedure First EditionTНў[—-—ц — —|БЈд=PˆОўRefrigerated Light Hydrocarbon Fluids - Liquefied Natural Gas - Procedure for Custody Transfer on Board Ship-First EditionTОўz—/—ш — —|БЈд=PTИ S•M—Ю — —|Б$д=PaЙ Environmental management systems Requirements with guidance for use-Second EditionTЙ S—2—Я — —|БYд=PTК ;Sampling Procedures and Tables for Inspection by AttributesTЛ ;Sampling Procedures and Tables for Inspection by AttributesШTМ ;Sampling Procedures and Tables for Inspection by AttributesКЉ@X)ISO 14000 SERIES - ENVIRONMENTAL COLLECTION-SEE ALSO ISO 9000 AND 14000 CDT)J—7—р — —|Бд=Pd*Belt Drives - V-Belts and V-Ribbed Belts - Calculation of Power Ratings Second Edition`+Information and Documentation - Records Management - Part 1: General-First EditionT+R—:—э — —|Бўд=Pš8ELECTRODES, WELDING, MINERAL COVERED, IRON-POWDER, LOW-HYDROGEN MEDIUM AND HIGH TENSILE STEEL, AS WELDED OR STRESS-RELIEVED WELD APPLICATIONT8Œ—<— — —|Бд=PT92ELECTRON TUBE, NEGATIVE GRID (MICROWAVE) TYPE 2C41P:ENGINE, AIRCRAFT, TURBOJET AND TURBOFAN, GENERAL SPECIFICATION FORT:B—?— — —|Бд=Pš;ELECTRODES, WELDING, MINERAL COVERED, IRON-POWDER, LOW-HYDROGEN MEDIUM AND HIGH TENSILE STEEL, AS WELDED OR STRESS-RELIEVED WELD APPLICATIONT;Œ—A— — —|Бд=PaЩ,Environmental mamagement systems Requirements with guidance for use-Second EditionTЩ,S—C— — —|Бд=PlЪ,General requirements for the competence of testing and calibration laboratories-Second editionTЪ,^—E— — —|Б д=P€м,Insert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340Tм,r—G—2 — —|Б д=P€н,Insert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340Tн,r—I—4 — —|Бд=Pо,Жо,Information Processing - Documentation Symbols and Conventions for Data, Program and System Flowcharts, Program Network Charts and System Resources Charts-First EditionTо,Ј—K—8 — —|Бд=Ps, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340Tн,r—I—4 — —|Бд=Pо,ўџЇЇPа4ўџАІћDˆŸEˆžEАžEр ћDА8™Ј•]F@ŸEТЂћDЬH ъ˜@ŸE€–]Fll Т Њ*жV–BсѓŸOћЇ ЙYѕЁIѕЁMљ˜D№hЋWЫsœHХ q  У i  Л g Й _ U  ­YСmещ•Aы—Aэ™Eё‘=щˆ4Д`џ8˜й3k˜Dз"TЌžПI{,˜ ˜|Быд=PhЌCompressed Breathing Air and Systems-Fourth Edition; General Instruction No 1; Update No 2TЌZ˜˜„,˜ ˜|Быд=P‘ЌGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558T‘Ќѓ˜˜ˆ,˜ ˜|Буд=P’ЌGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558T’Ќѓ˜˜Š,˜ ˜|Буд=P“ЌGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558T“Ќѓ˜˜Œ,˜ ˜|Буд=P”ЌGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558T”Ќѓ˜ ˜Ž,˜ ˜|Буд=P•ЌGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558T•Ќѓ˜ ˜,˜ ˜|Буд=P–ЌGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558T–Ќѓ˜ ˜,˜ ˜|Буд=P—ЌGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vfhicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558T—Ќѓ˜˜‘,˜ ˜|Буд=P˜ЌGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558T˜Ќѓ˜˜“,˜ ˜|Буд=P™ЌGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558T™Ќѓ˜˜—,˜ ˜|Буд=PšЌGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vejicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558TšЌѓ˜˜™,˜ ˜|Буд=P›ЌGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558T›Ќѓ˜˜œ,š ˜|Буд=PœЌGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558TœЌѓ˜˜ž,˜ ˜|Блд=PЌGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehjcle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558TЌѓ˜˜ ,˜ ˜|Бд=PlžЌInformation and Documentation - International Standard Audiovisual Number (ISAN)-First EditionTžЌ^˜˜Є,˜ ˜|Б†д=PlŸЌInformation and Documentation - International Standard Audiovisual Number (ISAN)-First EditionTŸЌ^˜˜І,˜ ˜|Б†д=Pm ЌGlossary of Terms Used in Information Processing (Fundamental Terms)-ISO/IEC 2382-1: 1993 (MOD)T Ќ_˜!˜Њ,˜ ˜|Б†д=PбЁЌGreenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhancements-First EditionTЁЌӘ#˜Ў,˜ ˜|БЛд=P’ЂЌGreenhouse gases Part 3: Specification with guidance for the validation and verification of greenhouse gas assertions-First EditionTЂЌ„˜%˜А,˜ ˜|БЛд=PЃЌSampling Procedures for Inspection by Attributes - Part 0: Introduction to the ISO 2859 Attribute Sampling System-First EditionTЃЌ˜'˜Д,˜ ˜|Бд=PЧЄЌSamrling Procedures for Inspection by Attributes - Part 1: Sampling Schemes Indexed by Acceptance Quality Limit (AQL) for Lot-by-Lot Inspection-Second Edition; Corrigendum 1: 03-01-2001TЄЌɘ)˜Ж,˜ ˜|Бд=PЂЅЌSampling Procedures for Inspection by Attributes - Part 2: Sampling Plans Indexed by Limiting Quality (LQ) for Isolated Lot Inspection-First EditionTЅЌ”˜+˜И,˜ ˜|Б†д=P tІЌSampling procedures for inspection by attributes - Part 3: Skip-lot sampling procedures-Second editionTІЌf˜-˜К,˜ ˜|БЛд=PŒЇЌSampling Procedures for Inspection by Attributes - Part 4: Procedures for Assessment of Declared Quality Levels-Second EditionTЇЌ~˜/˜М,˜ ˜|Быд=PwЈЌMedical Devices - Application of Risk Management to Medical Devices-First Fdition; Amendment 1: 3/01/2003TЈЌi˜1˜Р,˜ ˜|Б†д=PaЉЌEnvironmental management systems Requirements with guidance for use-Second EditionTЉЌS˜3˜Х,˜ ˜|Буд=PqЊЌQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TЊЌc˜5˜Щ,˜ ˜|Буд=PЋЌqЋЌQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994Х,˜ ˜|Буд=PЊЌqЊЌQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TЊЌc˜5˜Щ,˜ ˜|Буд=PЭ Ÿ q C  ч Й ‹ ] /  г Ѕ w I  э П ‘ c њ˜'гrЇSЧsџЋ Еюš Й'гЎAэ-СmlУТnm   Ф У o n  ХФpoЦХqpД`џH˜й)U™F94TЋЌc˜7Ы,™ ™|Буд=PSЌЌStandard Symbols for Welding, Brazing, and Nondestructive ExaminationTЌЌE™™б,™ ™|Бд=PT­Ќ7Quality Management Systems - Requirements-Third EditionКЉ@` ‹ЎЌPaints and varnishes Performance requirements for protective paint systems for offshore and related structures-First EditionTЎЌ}™™й,™ ™|Быд=P‹ЏЌPaints and varnishes Performance requirements for protective paint systems for offshore and related structures-First EditionTЏЌ}™™л,™ ™|Быд=PRАЌIndustrial Fans - Mechanical Safety of Fans - Guarding-First EditionTАЌD™™п,™ ™|Быд=PTБЌ.Underground Systems-General Instruction No 1-2`’‰I0ВлКЉ@` TВЌ.Underground Systems-General Instruction No 1-2`’‰I0ВлКЉ@` TГЌ*Overhead Systems-Seventh Edition; Update 3TДЌ*Overhead Systems-Seventh Edition; Update 3`ђјJ0ВуКЉ@` TЕЌ.Underground Systems-General Instruction No 1-2`ђјJ0ВуКЉ@` lЖЌGeneral requirements for the competence of testing and caljbration laboratories-Second editionTЖЌ^™™№,™ ™|Блд=PВЗЌStandard Test Method for Determining Rate of Air Leakage Through Exterior Windows, Curtain Walls, and Doors Under Specified Pressure Differences Across the SpecimenTЗЌЄ™™є,™ ™|БЛд=P€ИЌInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340VИЌr™™ј,™ ™|Буд=PTЙЌ Weldment Tooling and Positioning`RJ0ВлКЉ@` TКЌ Weldment Tooling and Positioning`В^E0ВлКЉ@` TЛЌ Weldment Tooling and Positioning`R;I0ВЛКЉ@` \МЌMinimum Design Loads for Buildings and Other Structures-Including Supplement 1TМЌN™™-™ ™|Бд=P^ЮЌMinimum Design Loads for Buildings and Other Structures-Including Supplement 1TЮЌN™™"-™ ™|Буд=PTЯЌ9Guide To The Use Of The Wind Load Provisions Of ASCE 7-02Љ@` юаЌInformation Technology - Open Systems Interconnection - Common Management Information Service Definition-Second Edition; Corrigendum 1-2: 1992; Amendment 4-1992; Corrigendum 3-1994; Corrigendum 4-1995; NZS/ISO/IEC 9595: 1991TаЌр™™+-™ ™|БЛд=PюбЌInformation Technology - Open Systems Interconnection - Common Management Information Service Definition-Second Edition; Corrigendum 1-2: 1992; Amendment 4-1992; Corrigendum 3-1994; Corrigendum 4-1995; NZS/ISO/IEC 9595: 1991TбЌр™™--™ ™|Б†д=PювЌInformation Technology - Open Systems Interconnection - Common Management Information Service Definition-Secnnd Edition; Corrigendum 1-2: 1992; Amendment 4-1992; Corrigendum 3-1994; Corrigendum 4-1995; NZS/ISO/IEC 9595: 1991TвЌр™!™/-™ ™|Блд=PюгЌInformation Technology - Open Systems Interconnection - Common Management Information Service Definition-Second Edition; Corrigendum 1-2: 1992; Amendment 4-1992; Corrigendum 3-1994; Corrigendum 4-1995; NZS/ISO/IEC 9595: 1991TгЌр™#™1-™ ™|Блд=PyдЌInformation Technology - Open Systems Interconnection - Common Management Information Service-Third EditionTдЌk™%™5-™ ™|Блд=PyеЌInformation Technology - Open Systems Interconnection - Common Management Information Service-Third EditionTеЌk™'™7-™ ™|Блд=PyжЌInformation Technology - Open Systems Interconnection - Common Management Information Service-Third EditionTжЌk™)™9-™ ™|Блд=PTзЌ<A DTV Profile for Uncompressed High Speed Digital InterfacesTиЌ<A DTV Profile for Uncompressed High Speed Digital InterfacesTйЌ<A DTV Profile for Uncompressed High Speed Digital InterfacesTкЌ<A DTV Profile for Uncompressed High Speed Digital InterfacesTлЌ<A DTV Profile for Uncompressed High Speed Djgital InterfacesTмЌ<A DTV Profile for Uncompressed High Speed Digital InterfacesTнЌ9Grey Scale for Assessing Change in Colour-Errata: 08/2005Љ@` TоЌ@Grey Scale for Assessing Staining-SWTF; Errata December 20, 2005TпЌPetroleum BenzineВ—G0рŽJ hє*JXц*JtВє*J,Г‡™GашŽJTрЌTolueneum BenzineВ—G0рŽJ hє*JXц*JtВє*J,Г‡™GашŽJTсЌKerosinem BenzineВ—G0рŽJ hє*JXц*JtВє*J,Г‡™GашŽJTтЌProtection des machinesР’€H0ВКЉ@ј уЌSafety of Machinery - Safety-Related Parts of Control Systems - Part 1: General Principles for Design-First EditionTуЌs™7™_-™ ™|Быд=P‹фЌSafety of Machinery - Guards - General Requirements for the Design and Construction of Fixed and Movable Guards-First EditionTфЌ}™9™a-™ ™|Блд=POхЌSafety of Machinery - Principles of Risk Assessment-First EditionTхЌA™;™d-™ ™|Б†д=P›цЌSafety of machinery Basic concepts, general principles for design Part 1: Basic terminology, methodology-First Edition; Replaces TR 12100-1TцЌ™=™f-™ ™|Б†д=PŒчЌPlastics - Determination of Fracture Toughness (Gic and Kic) - Linear Elastjc Fracture Mechanics (LEFM) Approach-First EditionTчЌ~™?™j-™ ™|Буд=PшЌPlastics Determination of fracture toughness (GIC and KIC) Linear elastic fracture mechanics (LEFM) approach AMENDMENT 1: Guidelines for the testing of injection-moulded plastics containing discontinuous reinforcing fibres-First Edition; Amendment 1:6/1/2003TшЌ™A™l-™ ™|Буд=PŒщЌPlastjcs - Determination of Fracture Toughness (Gic and Kic) - Linear Elastic Fracture Mechanics (LEFM) Approach-First EditionTщЌ~™C™r-™ ™|БЛд=PŒъЌCopper, Lead and Zinc Sulfide Concentrates - Sampling Procedures for Determination of Metal and Moisture Content-First EditionTъЌ~™E™x-™ ™|Бд=PыЌ›ыЌZinc Sulfide Concentrates - Determination of Silver Convent - Acid Dissolution and Flame Atomic Absorption Spectrometric Method-First EditionSampling Procedures for Determination of Metal and Moisture Content-First EditionTъЌ~™E™x-™ ™|Бд=PА]DPТDDx ™P ™ 2D А]DКXЬxь˜†2ІRЗcР5с` ИdМhРlФpЃOж‚ ЕЧs… 1 C я  ­ Y § Љ M љЅQ§})w#ЗcЛgПmŽ:Џ[Д`џ>˜йb0šG ў€%TыЌ™Gz-š š|Буд=P›ьЌZinc Sulfide Concentrates - Determination of Silver Content - Acid Dissolution and Flame Atomic Absorption Spectrometric Method-First EditionTьЌšš-š š|Буд=PŒэЌCopper, Lead and Zinc Sulfide Concentrates - Sampling Procedures for Determination of Metal and Moisture Content-First EditionTэЌ~ššƒ-š š|Буд=P‚юЌABOVEGROUND STEEL TANKS FOR THE STORAGE OF COMBUSTIBLE LIQUIDS INTENDED TO BE USED AS HEATING AND/OR GENERATOR FUELSTюЌtššˆ-š š|БЛд=PЕяЌGreenhouse gases Part 1: Specification with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removalr-First EditionTяЌЇššŒ-š š|Б†д=Pб№ЌGreenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhancements-First EditionT№ЌУš šŽ-š š|Б†д=P’ёЌGreenhouse gases Part 3: Specification with guidance for the validation and verification of greenhouse gar assertions-First EditionTёЌ„š š-š š|Б†д=PЕђЌGreenhouse gases Part 1: Specification with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-First EditionTђЌЇš š’-š š|Бд=PбѓЌGreenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of freenhouse gas emission reductions or removal enhancements-First EditionTѓЌУšš”-š š|Бд=P’єЌGreenhouse gases Part 3: Specification with guidance for the validation and verification of greenhouse gas assertions-First EditionTєЌ„šš–-š š|Бд=PlѕЌGeneral requirements for the competence of testing and calibration laboratories-Second editionTѕЌ^šš-š š|БЛд=PlіЌGeneral requirements for the competence of testing and calibration laboratories-Second editionTіЌ^ššŸ-š š|БЛд=PЊїЌPortable Electrical Motor-Operated and Heating Appliances: Particular Requirements for Electrical Motor-Operated Kitchen Appliances-General Instruction No 1TїЌœššЅ-š š|БЛд=P …јЌPortable Electrical Motor-Operated and Heating Appliances: General Requirements-First Edition; General Instruction No 1TјЌwššЊ-š š|Буд=PxљЌGeneral requirements for the competence of testing and calibration laboratories-Same as IEC/ISO 17025:2005TљЌjššЎ-š š|Блд=P~њЌInformation technology Security techniques Code of practice for information"security management-Second EditionTњЌpššВ-š š|Б†д=PlћЌGeneral requirements for the competence of testing and calibration laboratories-Second editionTћЌ^ššЖ-š š|Б†д=PќЌSampling Procedures for Inspection by Attributes - Part 0: Introduction to the ISO 2859 Attribute Sampling System-First EditionTќЌš!šК-š š|Бд=P›§ЌZinc Sulfide Concentrates - Determination of Silver Content - Acid Dissolution and Flame Atomic Absorption Spectrometric Method-First EditionT§Ќš#šП-š š|Буд=PИўЌInformation technology Radio frequency identification for item management Part 6: Parameters for air interface communications at 860 MHz to 960 MHz-ISO/IEC 18000-6:2004TўЌЊš%šУ-š š|Блд=PqџЌQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TџЌcš'šЧ-š š|БЛд=PЕ­Ophthalmic Optics - Specifications for Material, Optical and Dimensional Properties of Contact Lenses - Part 1: Rigid Corneal and Scleral Contact Lenses-Second EditionT­Їš)šЫ-š š|БЛд=PУ­Composite Insulatnrs - Hollow Insulators for Use in Outdoor and Indoor Electrical Equipment - Definitions, Test Methods, Acceptance Criteria and Design Recommendations-First EditionT­Еš+šЯ-š š|Быд=PУ­Composite Insulators - Hollow Insulators for Use in Outdoor and Indoor Electrical Equipment - Definitions, Test Methods, Acceptance Criteria and Design Recommendations-First EditionT­Еš-šб-š š|Блд=PУ­Composite Insulators - Hollow Insulators for Use in Outdoor and Indoor Electrical Equipment - Definitions, Test Methods, Acceptance Criteria and Design Recommendations-First EditionT­Еš/šв-š š|Блд=PУ­Composite Insulators - Hollow Insulators for Use in Outdoor and Indoor Electrical Equipment - Definitions, Test Methods, Acceptance Criteria and Design Recommendations-First EditionT­Еš1šд-š š|Блд=PЕ­Greenhouse gases Part 1: Specification with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-First EditionT­Їš3šй-š š|БЛд=Pб­Greenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhbncements-First EditionT­Уš5šл-š š|БЛд=P’­Greenhouse gases Part 3: Specification with guidance for the validation and verification of greenhouse gas assertions-First EditionT­„š7šн-š š|БЛд=P­Sampling procedures for inspection by variables Part 1: Specification for single sampling plans indexed by acceptance quality limit (AQL) for lot-by-lot inspectjon for a single quality characteristic and a single AQL-First edition; Cancels and Replaces ISO 3951:1989T­ š9šџ-š š|Бд=P­Sequential Sampling Plans for Inspection by Variables for Percent Nonconforming (Known Standard Deviation)-First Edition; Corregendum 1 - 1993;T­š;š.š š|Буд=P­t­Sampling procedures for inspection by attributes - Part 3: Skip-lot sampling procedures-Second editionš š|Бд=P­­Sequential Sampling Plans for Inspection by Variables for Percent Nonconforming (Known Standard Deviation)-First Edition; Corregendum 1 - 1993;T­š;š.š š|Буд=PІxJюР’d6к Ќ ~ P " є Ц ˜ j <  р В „ МZНiPќjEё<ш%бКїЃрŒзƒОВУ6тv"Є P и „ џ Ћ  ­ A э  - ›Gv"m‡3bYƒ/ЃOД`џB˜йy›GчV T­fš=.› ›|Буд=Pо­Sampling Procedures for Inspection by Attributes - Part 1: Sampling Plans Indexed by Acceptable Quality Level (AQL) for Lot-by-Lot Inspection First Edition; (Technical Corrigendum 1 - 1993) (PNS 1249-1: 1994)T­а››.› ›|Буд=P­Sampling procedures for inspection by variables Part 1: Specification for single sampling plans indexed by acceptance quality limit (AQL) for lot-by-lot inspection for a single quality characteristic and a single AQL-First edition; Cancels and Replaces ISO 3951:1989T­ ›› .› ›|БЛд=P­Sampling procedures for inspection by variables Part 1: Specification for single sampling plans indexed by acceptance quality limit (AQL) for lot-by-lot inspfction for a single quality characteristic and a single AQL-First edition; Cancels and Replaces ISO 3951:1989T­ ›› .› ›|Б†д=Pt­Sampling procedures for inspection by attributes - Part 3: Skip-lot sampling procedures-Second editionT­f››.› ›|Быд=P) ­Structural Standard for Antenna Supporting Structures and Antennas-EFFECTIVE JANUARY 1, 2006; Includes Covnty Listing 07/20/2005 after TIA-222-G standard - Please contact Global Engineering Documents (1-800-447-3352 ext.4960) for a electronic version of the 07/20/2005 County ListingT ­› ›.› ›|БЛд=Pi!­Food safety management systems Guidance on the application of ISO 22000:2005-First EditionT!­[› ›.› ›|БЛд=PУ"­Composite Insulators - Hollow Insulators for Usf in Outdoor and Indoor Electrical Equipment - Definitions, Test Methods, Acceptance Criteria and Design Recommendations-First EditionT"­Е› ›#.› ›|Б†д=P^#­Parallel Pins, of Unhardened Steel and Austenitic Stainless Steel-Second EditionT#­P››'.› ›|Блд=Pg$­Road Vehicles - Vehicle Identification Number (VIN) - Content and Structure Third EditionT$­Y››+.› ›|Блд=Po%­Food safety management systems Requirements for any organization in the food chain-First EditionT%­a››/.› ›|Быд=PT&­1Emergency Preparedness and Response-Third Edition'­Quality management - Customer satisfaction - Guidelines for complaints handling in organizations (ISO 10002:2004)T'­q››7.› ›|Бд=PT(­@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176T)­@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176T*­@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176h+­Solar Domestic Hot Water Systems (Liquid to Liquid Heat Transfer)-General Instruction No 1T+­Z››B.› ›|БЛд=PT,­Seasonal Vse Solar Domestic Hot Water Systems-General Instruction No 1T,­F››D.› ›|Б†д=PT-­)Solar Collectors-General Instruction No 1Ы7MмГ†l.­Installation Code for Solar Domestic Hot Water Systems-First Edition; General Instruction No 1T.­^› ›H.› ›|Блд=Pб/­Greenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhancements-First EditionT/­У›"›P.› ›|Бд=P’0­Greenhouse gases Part 3: Specification with guidance for the validation and verification of greenhouse gas assertions-First EditionT0­„›$›R.› ›|Бд=PU1­Welding Consumables Fluxes for Submerged Arc Welding Classification (F)T1­G›&›\.› ›|Б†д=P 2­Welding consumables - Technical delivery conditions for welding filler metals - Type of product, dimensions, tolerances and marking (ISO 544:2003)T2­’›(›^.› ›|Б†д=PУ3­Composite Insulators - Hollow Insulators for Use in Outdoor and Indoor Electrical Equipment - Definitions, Test Methods, Acceptance Criteria and Design Recommendations-First EditionT3­Е›*›d.› ›|Быд=PУ4­Composite Insulators - Hollow Insulators for Use in Outdoor and Indoor Electrical Equipment - Definitions, Test Methods, Acceptance Criteria and Design Recommendations-First EditionT4­Е›,›h.› ›|Быд=PO5­Standard Specification for Aluminum-Alloy Permanent Mold CastingsT5­A›.›l.› ›|Быд=PO6­Standard Specification for Aluminum-Alloy Permanent Mold CastingsT6­A›0›o.› ›|Быд=Pl7­General requirements for the competence of testing and calibration laboratories-Second editionT7­^›2›t.› ›|Буд=Pl8­General requirements for the competence of testing and calibration laboratories-Second editionT8­^›4›x.› ›|Быд=PЌ9­Electromagnetic Compatibility (EMC) - Part 4-2: Testing and Measurement Techniques - Electrostatic Discharge Immunity Test-First Edition; Amendment 2: 06/2003T9­ž›6›|.› ›|Б†д=P›:­Safety of machinery Basic concepts, general principles for design Part 1: Basic terminology, methodology-First Edition; Replaces TR 12100-1T:­›8›„.› ›|Быд=Pб;­Greenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhancements-First EditionT;­У›:›ˆ.› ›|Блд=P’<­Greenhouse gases Part 3: Specification with guidance for the validation and verification of greenhouse gas assertions-First EditionT<­„›<›Š.› ›|Блд=PЕ=­Greenhouse gases Part 1: Specification with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-First EditionT=­Ї›>›Œ.› ›|Быд=Pl>­General requirements for the competence of testing and calibration laboratories-Second editionT>­^›@›‘.› ›|Блж=P with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-First EditionT=­Ї›>›Œ.› ›|Быд=P>­l>­General requirements for the competence of testing and calibration laboratories-Second edition)ћЭŸqCщ М  b 5  л Ў  T ' њ ЏCя:цT/л@ь@ь€,РlЩz&cLјXЏ[ЩuЄPф<ш ” , и „ 0 м ] Е F ђ ‹ 7 й…ТnБˆ4РlSџц’Д`џK˜йaœGЈD0l?­General requirements for the competence of testing and calibration laboratories-Second editionT?­^œœ“.œ œ|Блд=Pl@­General requirements for the competence of testing and calibration laboratories-Second editionT@­^œœ–.œ œ|Блд=PiA­Information Technology - Code of Practice For Information Security Management-First EditionTA­[œœ™.œ œ|Блд=PiB­Information Technology - Code of Practice For Information Security Management-First EditionTB­[œœ›.œ œ|Быд=PqC­Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TC­cœœ.œ œ|Бд=PnD­Sterilization of medical devices - Validation and routine control of sterilization by moist heatTD­`œ œЃ.œ œ|Буд=PTE­%Freight containers - Mechanical sealsВЛЭЋL0 ]JpŽЬC\§D4ВЛКЉ@nF­Sterilization of medical devices - Validation and routine control of sterilization by moist heatTF­`œ œЇ.œ œ|Б†д=PnG­Sterilization of medical devices - Validation and routine control of sterilization by moist heatTG­`œœЉ.œ œ|Б†д=PTH­<Supplementary Cementing Materials-General Instruction No 1-2` ŸI­Information Systems - Programming Language - Intrinsic Function Module for COBOL-Replaces ANSI X3.23-1985; Supplement A: 1989; Supplement B: 1993TI­‘œœВ.œ œ|Блд=PlJ­General requirements for the competence of testing and calibration laboratories-Second editionTJ­^œœЖ.œ œ|Буд=PlK­General requirements for the competence of testing and calibration laboratories-Second editionTK­^œœИ.œ œ|Быд=PTL­Quality Management Systems - Fundamentals and Vocabulary-Third EditionTL­FœœМ.œ œ|Быд=PqM­Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TM­cœœО.œ œ|Бд=P}N­Quality Management Systems - Guidelines for Performance Improvements-Second Edition; Supersedes ISO 9004-1:1994TN­oœœР.œ œ|Бд=PƒO­Environmental Management Systems - General Guidelinfs on Principles, Systems and Supporting Techniques-Second EditionTO­uœœТ.œ œ|Бд=PжP­Guidelines for Quality and/or Environmental Management Systems Auditing-First Edition; Replaces ISO 10011-1:1990, ISO 10011-2:1991, ISO 10011-3:1991, ISO 14010:1996, ISO 14011:1996, and ISO 14012:1996TP­Шœ œФ.œ œ|Бд=PaQ­Environmental management systems Requirements witj guidance for use-Second EditionTQ­Sœ"œЦ.œ œ|БЛд=PtR­Guidelines for the selection of statistical methods in standardization and specification-Third EditionTR­fœ$œШ.œ œ|БЛд=POS­Safety of Machinery - Principles of Risk Assessment-First EditionTS­Aœ&œЮ.œ œ|Блд=P‘T­Safety of machinerz Basic concepts, general principles for design Part 2: Technical principles-First Edition; Replaces TR 12100-2TT­ƒœ(œд.œ œ|Быд=P‘U­Safety of machinery Basic concepts, general principles for design Part 2: Technical principles-First Edition; Replaces TR 12100-2TU­ƒœ*œж.œ œ|Быд=P‘V­Safety of machinery Basic concepts, general principles for design Part"2: Technical principles-First Edition; Replaces TR 12100-2TV­ƒœ,œи.œ œ|Быд=P‘W­Safety of machinery Basic concepts, general principles for design Part 2: Technical principles-First Edition; Replaces TR 12100-2TW­ƒœ.œй.œ œ|Быд=PaX­Environmental management systems Requirements with guidance for use-Second EditionTX­Sœ0œл.œ œ|Б†д=POY­Safety of Machinery - Principles of Risk Assessment-First EditionTY­Aœ2œу.œ œ|Бд=PŠZ­Small craft - Windows, portlights, hatches, deadlights and doors - Strength and watertightness requirements (ISO 12216:2002)TZ­|œ4œщ.œ œ|Б†д=PŠ[­Small craft - Windows, portlights, hatches, deadlights and doors - Strenfth and watertightness requirements (ISO 12216:2002)T[­|œ6œы.œ œ|Быд=P]\­A DTV Profile for Uncompressed High Speed Digital Interfaces-Errata: 11/24/2004T\­Oœ8œё.œ œ|БЛд=PT]­:DTV Profile for Uncompressed High Speed Digital Interfaces@ј s^­Standard for Central and Monitoring Station Burglar Alarm Units-Amended May, 1990; Amended June, 1993 T^­eœ;œ/œ œ|Буд=Ps_­Standard for Central and Monitoring Station Burglar Alarm Units-Amended May, 1990; Amended June, 1993T_­eœ=œ/œ œ|Буд=Pq`­Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T`­cœ?œ /œ œ|Б†д=PTa­National Elebtrical Safety CodeР LTTb­National Electrical Safety CodeKlКуpрпI8SK0ВуКЉ@€ Oc­Automotive Biodiesel - Specification for Manufacture and BlendingTc­AœCœ/œ œ|Бд=P’d­Carburant diesel a faible teneur en soufre, pour vehicules automobiles, contenant de faibles quantites dДesters de biodiesel (B1-B5)Td­„œEœ/œ œ|БУд=PЕe­Greenhouse gases Part 1: Specification with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-First EditionTe­ЇœGœ/œ œ|Бд=Pf­œf­Rubber, Vulcanized or Thermoplastic - Determination of Hardness (Hardness Between 10 IRHD and 100 IRHD)-Third Edition; Amendment 1: 08-15-1999Tf­ŽœIœ"/ž œ|БУд=Pguidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-First EditionTe­ЇœGœ/œ œ|Бд=P,ўаЂtFъМŽ`2жЈzL№Т”f8 мЎ€R$іШšl>тД†X*ќЮ rDшКŒ^0дІxJюР’d6к У'ХМ*ж‡3п‹ЦSџŒ8ф‡3ЉUЫw(дsŽ:ЉUФpп‹<шt П k • A О j э ™ ( д € , РlЌ ЙeїЃ5сЫZIрŒ Ь`џL˜й^Hд’# œg­Rubber, Vulcanized or Thermoplastic - Determination of Hardness (Hardness Between 10 IRHD and 100 IRHD)-Third Edition; Amendment 1: 08-15-1999Tg­Ž(/ |Бд=Plh­General requirements for the competence of testing and calibration laboratories-Second editionTh­^0/ |Бд=Pli­General requirements for the competence of testing and calibration laboratories-Second editionTi­^4/ |Бд=Plj­General requirements for the competence of testing and calibration laboratories-Second editionTj­^6/ |БУд=Plk­General requirements for the competence of testing and calibration laboratories-Second editionTk­^8/ |БУд=Pll­General requirements for the competence of testing and calibration laboratories-Second editionTl­^ Г/ |Бд=Pу™­Precast Concrete Products - Test Method for Glass-Fibre Reinforced Cement Part 3: Measuring the Fibre Content of Sprayed GRC-This Standard, Together with BS EN 1170: Parts 1,2 and 4 to 7, Supersedes BS 6432: 1984;T™­е@Л/ |БУд=PaŸ­Environmental management systems Requirements with guidance for use-Second EditionTŸ­SBЪ/ |БЬд=Pa ­Environmental management systems Requirements with guidance for use-Second EditionT ­SDЬ/ |БЬд=PaЁ­Envirommental management systems Requirements with guidance for use-Second EditionTЁ­SFа/ |БLд=PaЂ­Environmental management systems Requirements with guidance for use-Second EditionTЂ­SHв/ |БLд=PЃ­aЃ­Environmental management systems Requirements with guidance for use-Second EditionTЃ­SJд/ |БLд=PSecond EditionTЁ­SFа/ |БLд=PЂ­aЂ­Environmental management systems Requirements with guidance for use-Second EditionTЂ­SHв/ |БLд=PыО‘d7 нАƒV)ќЯЂuHю Фc Lы—6т-JіŠ6мˆ‡3‡3мˆ ЖLјŽ:Йe LрŒ Ь`   L р Œ Ь `   L р Œ 8 ЮzМPќ<а|МPќ<а|МPќ`џH˜йˆшžIА@1aš­Environmental management systems Requirements with guidance for use-Second EditionTš­SžžН/ž ž|БЬд=Pa›­Environmental management systems Requirements with guidance for use-Second EditionT›­SžžР/ž ž|БЬд=Paœ­Environmental management systems Requirements with guidance for use-Second EditionTœ­SžžТ/ž ž|БЬд=Pa­Environmental management systems Requirements with guidance for use-Second EditionT­SžžФ/ž ž|Бід=Paž­Environmental management systems Requirements with guidance for use-Second EditionTž­SžžЦ/ž ž|Бід=P_Є­Example nf statistical analysis of wet runway friction: ground-test machine data.TЄ­Qž žж/ž ž|БLд=PeЅ­Sequential Sampling Plans for Inspection by Attributes-First Edition; Corrigendum: 1993TЅ­Wž žр/ž ž|Бд=PeІ­Sequential Sampling Plans for Inspection by Attributes-First Edition; Corrigendum: 1993TІ­Wžžт/ž ž|БУд=P]Ї­Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TЇ­Ožžщ/ž ž|БУд=P`Ј­Microfilms Et Images Electroniques - Preuve Documentaire-Modificataf 1: Avril 2000TЈ­Ržžы/ž ž|Бд=PЉ­General Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance"to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558TЉ­ѓžžѓ/ž ž|Бд=PЊ­General Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558TЊ­ѓžžї/ž ž|Бд=PЋ­General Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558TЋ­ѓžžљ/ž ž|Б›д=PlЌ­General requirements for the competence of testing and calibration laboratories-Second editionTЌ­^žžџ/ž ž|БУд=P­­Information technology International symbology specification Data matrix-ISO/IEC 16022:2000; Corrigendum 1:2005T­­qžž0ž ž|Бд=PБЎ­Information technology Automatic identification and data capture techniques Bar code print quality test specification Two-dimensional symbols-ISO/IEC 15415:2004TЎ­Ѓžž0ž ž|Бд=PlЏ­General requirements for the competence of testing and calibration laboratories-Second editionTЏ­^ž ž0ž ž|Бд=P~А­Information technology Security techniques Code of practice for information security management-Second EditionTА­pž"ž 0ž ž|БУд=P~Б­Information technology Security techniques Code of practice for information securitz management-Second EditionTБ­pž$ž 0ž ž|Б›д=PВ­Petroleum Industry - Terminology - Part 5: Transport, Storage, Distribution-First Edition; Corrigendum 1 07/15/1999TВ­sž&ž0ž ž|Б›д=P\Г­Vapour Barrier Sheet, Excluding Polyethylene, for Use in Building ConstructionTГ­Nž(ž0ž ž|Б›д=P\Д­Vapour Barrier Sheet, Excluding Polyethylene, for Use in Building ConstructionTД­Nž*ž0ž ž|БУд=P\Е­Vapour Barrier Sheet, Excluding Polyethylene, for Use in Building ConstructionTЕ­Nž,ž0ž ž|БУд=PkЖ­Vapor Barrier, Polyethylene Sheet for Use in Building Construction-Amendment 1: November 1988TЖ­]ž.ž0ž ž|БУд=PTЗ­(Method for Permeance of Coated Wallboard`ђM0ВУКЉ@` TИ­(Method for Permeance of Coated Wallboard`r>L0В›КЉ@` yЙ­Information technology Security techniques information security incident management-ISO/IEC TR 18044:2004TЙ­kž2ž)0ž ž|БУд=PhК­Qualification test of welders Fusion welding Part 1: Steels-CORR 15598:February 17, 2005TК­Zž4ž-0ž ž|Бд=PnЛ­Non-Destructive Testing - Penetrant Testing Part 1: General Principles-Supersedes BS 6443: 1984;TЛ­`ž6ž/0ž ž|БУд=PюМ­Non-destructive testing of welds Radiographic testing of welded joints-CORR 10616:August 1999; AMD 13985:November 15, 2002; AMD 14938:March 15, 2004; Supersedes BS 2600-1:1983, BS 2600-2:1973, BS 2910:1986 and BS 7257:1989;TМ­рž8ž10ž ž|БУд=PTН­@Non-Destructive Examination of Fusion Welds - Visual Examination]О­Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TО­Ož;ž90ž ž|БУд=PЅП­Household and similar electrical appliances – Safety – Part 2-76: Particular requirements for electric fence energizers-Edition 2; Amendment 1: 02/2006TП­—ž=ž=0ž ž|Бд=P›Р­Zinc Sulfide Concentrates - Determination of Silver Content - Acid Dissolution and Flame Atomic Absorption Spectrometric Method-First EditionTР­ž?žB0ž ž|Бд=P]С­Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TС­OžAžF0ž ž|Б›д=P›Т­Zinc Sulfide"Concentrates - Determination of Silver Content - Acid Dissolution and Flame Atomic Absorption Spectrometric Method-First EditionTТ­žCžJ0ž ž|БУд=PlУ­General requirements for the competence of testing and calibration laboratories-Second editionTУ­^žEžP0ž ž|Бд=PTФ­*Industrial Control Equipment-Tenth Edition`RM0ВКЉ@` tent - Acid Dissolutinn and Flame Atomic Absorption Spectrometric Method-First EditionTТ­žCžJ0ž ž|БУд=PУ­lУ­General requirements for the competence of testing and calibration laboratories-Second editionTУ­^žEžP0ž ž|Бд=P6к Ќ ~ P ”@д€х‘4рEёLј›GѓБCя‡3КfОSџЃOѓŸCяnœHЪv Ж  Б 2 о r   Щ ШtsПkКUœHщ•4р+ЪvС`џI˜йbŸJ v§%lХ­Engineering Design in Wood-Eighth Edition; Update No 1; Supplement 1-2005; Reprinted June 2005TХ­^ŸŸV0Ÿ Ÿ|Бд=PxЦ­Code sur les chaudiшres, les appareils et les tuyauteries sous pression-Seiziшme Edition; Mise р jour no 1TЦ­jŸŸY0Ÿ Ÿ|Бд=PsЧ­Bщton : Constituants et exщcution des travaux/Mщthodes d’essai et pratiques normalisщes pour le bщtonTЧ­eŸŸ[0Ÿ Ÿ|Бд=PlШ­General requirements for the competence of testing and calibration laboratories-Second editionTШ­^ŸŸb0Ÿ Ÿ|Бд=PlЩ­General requirements for the competence of testing and calibration laboratories-Second editionTЩ­^ŸŸf0Ÿ Ÿ|Бд=PlЪ­General requirements for the competence of testing and calibration laboratories-Second editionTЪ­^Ÿ Ÿh0Ÿ Ÿ|Б›д=PlЫ­General requirements for the competence of testing and calibration laboratories-Second editionTЫ­^Ÿ Ÿj0Ÿ Ÿ|Бд=PaЬ­Environmental management systems Requirements with guidance fnr use-Second EditionTЬ­SŸŸo0Ÿ Ÿ|БУд=P_Э­Information technology - Service management - Part 1: Specification-First EditionTЭ­QŸŸs0Ÿ Ÿ|Бд=PbЮ­Information technology - Service management - Part 2: Code of practice-First EditionTЮ­TŸŸu0Ÿ Ÿ|Бд=PTЯ­Lifting Points A Design GujdehtўLXfўLtВtўL,Г‡™Gаш*J{а­Measurement Management Systems - Requirements for Measurement Processes and Measuring Equipment-First EditionTа­mŸŸ}0Ÿ Ÿ|Бд=PTб­*Electronic Records as Documentary Evidence`ђ M0В›КЉ@` бв­Greenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal fnhancements-First EditionTв­УŸŸ”0Ÿ Ÿ|БУд=PRф­Model Code for the Protection of Personal Information-Second EditionTф­DŸŸГ0Ÿ Ÿ|Б›д=PRх­Model Code for the Protection of Personal Information-Second EditionTх­DŸŸЕ0Ÿ Ÿ|Бд=PRц­Model Code for the Protection of Personal Information-Sebond EditionTц­DŸŸЗ0Ÿ Ÿ|Бд=PTч­@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176Tш­@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176Tщ­@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176ˆъ­PHOSPHATE COATING PLUS OIL - 96 HOURS ***TO BE USED WITH FORD WSS-M99P1111-A***-Shown on ESB-M3P4-A; Use FORD WSS-M3P36-A2Tъ­zž#ŸЩ0Ÿ Ÿ|Бд=Pˆы­PHOSPHATE COATING PLUS OIL - 96 HOURS ***TO BE USED WITH FORD WSS-M99P1111-A***-Shown on ESB-M3P4-A; Use FORD WSS-M3P36-A2Tы­zŸ%ŸЫ0Ÿ Ÿ|Бд=Pˆь­PHOSPHATE COATING PLUS OIL - 96 HOURS ***TO BE USED WITH FORD WSS-M99P1111-A***-Shown on ESB-M3P4-A; Use FORD WSS-M3P36-A2Tь­zŸ'ŸЬ0Ÿ Ÿ|Бд=Pˆэ­PHNSPHATE COATING PLUS OIL - 96 HOURS ***TO BE USED WITH FORD WSS-M99P1111-A***-Shown on ESB-M3P4-A; Use FORD WSS-M3P36-A2Tэ­zŸ)ŸЮ0Ÿ Ÿ|Бд=Pˆю­PHOSPHATE COATING PLUS OIL - 96 HOURS ***TO BE USED WITH FORD WSS-M99P1111-A***-Shown on ESB-M3P4-A; Use FORD WSS-M3P36-A2Tю­zŸ+ŸЯ0Ÿ Ÿ|Бд=P_я­Information technology - Service management - Part 1: Specification-First FditionTя­QŸ-Ÿз0Ÿ Ÿ|БУд=PЊ№­Personal Flotation Devices-Amendment 1: November 1990; Amendment 3: July 1996; Incorporates Amendment 2; Amendment 4: January 1997; Corrigendum: August 2000T№­œŸ/Ÿн0Ÿ Ÿ|Бд=PЙё­Personal Flotation Devices for Children-Amendment 1: November 1990; Amendment 2: February 1993; Amendment 3: July 1996; Amendment 4: January 1997; Corrigfndum: August 2000Tё­ЋŸ1Ÿп0Ÿ Ÿ|Бд=PЙђ­Personal Flotation Devices for Children-Amendment 1: November 1990; Amendment 2: February 1993; Amendment 3: July 1996; Amendment 4: January 1997; Corrigendum: August 2000Tђ­ЋŸ3Ÿс0Ÿ Ÿ|Бд=PЙѓ­Personal Flotation Devices for Children-Amendment 1: November 1990; Amendment 2: February 1993; Amendment 3: July 1996; Amendment 4: January 1997; Corrigendum: August 2000Tѓ­ЋŸ5Ÿу0Ÿ Ÿ|Б›д=PYє­GREASE - REDUCED POLYETHYLENE 1-3 ***TO BE USED WITH FORD WSS-M99P1111-A***Tє­KŸ7Ÿч0Ÿ Ÿ|Бд=Paѕ­Environmental management systems Requirements with guidance for use-Second EditionTѕ­SŸ9Ÿы0Ÿ Ÿ|Бд=PYі­GREASE - REDUCED"POLYETHYLENE 1-3 ***TO BE USED WITH FORD WSS-M99P1111-A***Tі­KŸ;Ÿэ0Ÿ Ÿ|Бд=Puї­ISO General Purpose Metric Screw Threads - Tolerances - Part 1: Principles and Basic Data-Third EditionTї­gŸ=Ÿѓ0Ÿ Ÿ|БУд=PДј­ISO General Purpose Metric Screw Threads - Tolerances - Part 2: Limits of Sizes for General Purpose External and Internal Screw Threads - Medium Quality-Tjird EditionTј­ІŸ?Ÿѕ0Ÿ Ÿ|Б›д=Puљ­ISO General Purpose Metric Screw Threads - Tolerances - Part 1: Principles and Basic Data-Third EditionTљ­gŸAŸљ0Ÿ Ÿ|Бд=PДњ­ISO General Purpose Metric Screw Threads - Tolerances - Part 2: Limits of Sizes for General Purpose External and Internal Screw Threads - Medium Quality-Third EditionTњ­ІŸCŸћ0Ÿ Ÿ|Бд=P­ћ­Foodstuffs Methods of analysis for the detection of genetically modified organisms and derived products Quantitative nucleic acid based methods-First EditionTћ­ŸŸEŸ 1Ÿ Ÿ|Бд=Pќ­‡ќ­ISO General Purpose Metric Screw Threads - Tolerances - Part 3: Deviations for Constructional Screw Threads-Third EditionTќ­yŸGŸ1Ÿ Ÿ|Бд=Ps for the detection of genetically modified organisms and derived products Quantitative nucleic acid based methods-First EditionTћ­ŸŸEŸ 1Ÿ Ÿ|Бд=PеЇyKёФ—j=уЖ‰\/еЈ{N!єЧšm@цЙŒ_2иЋ~Q$їЪpDьР”h<фИŒ`4к Ќ ~ Ц?н0м(д_ WŽ:с,и+reXZЇSЫwя›П7у [  Г _ Й e  П m  H є %б}ЧhГ_ѓŸ3пsГ_ь˜ Ь`џJ˜й}я #+ЌPWЯAASHTO LRFD Bridge Design Specifications - SI Units-Fourth EditionTWЯB 8EjE hFjbpEj€EjˆEjFjpEjpEjUXЯInformation technology - Coding of audio-visual objects - Part 3: AudioTXЯG 8EjE hFjbpEj€EjˆEjFjpEjpEjUYЯInformation technology - Coding of audio-visual objects - Part 3: AudioTYЯG 8ErE hFrbpEr€ErˆErFrpErpErUZЯInformation technology - Coding of audio-visual objects - Part 3: AudioTZЯG 8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3pE_3U[ЯInformation technology - Coding of audio-visual objects - Part 3: AudioT[ЯG 8Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3pEp3T\Я;Quality management systems — Requirements-Quatriшme щditionT]Я8Quality Management Systems - Requirements-Fourth EditionP^ЯAASHTO LRFD Bridge Design Specifications - SI Units-Fourth EditionT^ЯB  8ErE hFrbpEr€ErˆErFrpErpErl_ЯGeneral requirements for the competence of testing and calibration laboratories-Second editionT_Я^ 8EћE hFћbpEћ€EћˆEћFћpEћpEћl`ЯGeneral requirements for the competence of testing and calibrbtion laboratories-Second editionT`Я^ 8Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3‚aЯSpecification for Unfired fusion welded pressure vessels-AMD: September 2006; AMD: October 2007; AMD: September 2008TaЯt 8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓPbЯAASHTO LRFD Bridge Design Specifications - SI Units-Fourth EditionTbЯB 8EФ3E hFФ3bpEФ3€EФ3ˆEФ3FФ3pEФ3pEФ3PcЯAASJTO LRFD Bridge Design Specifications - SI Units-Fourth EditionTcЯB 8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓadЯEnvironmental management systems Requirements with guidance for use-Second EditionTdЯS 8Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3šeЯGreenhouse gases - Requirements for greenhouse gas validation and verification bodies for use in accreditation or other forms of recognitionTeЯŒ 8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3cfЯInformation technology - Biometric data interchange formats - Part 5: Face image dataTfЯU 8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3cgЯInformation technology - Biometric data interchange formats - Part 5: Face image dataTgЯU 8EћE hFћbpEћ€EћˆEћFћpEћchЯInformation technology - Biometric data interchange formats - Part 5: Face imafe dataThЯU  8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3giЯGuidelines and Procedures for Entering and Cleaning Petroleum Storage Tanks-First EditionTiЯY "8EЬ3E hFЬ3bpEЬ3€EЬ3ˆEЬ3FЬ3pEЬ3qjЯInformation technology - Security techniques - Code of practice for information security managementTjЯc $8ErE hFrbpEr€ErˆErFrpErqkЯInformation technology . Security techniques - Code of practice for information security managementTkЯc &8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3`lЯInformation and Documentation - Records Management - Part 1: General-First EditionTlЯR (8EИ3E hFИ3bpEИ3€EИ3ˆEИ3FИ3pEИ3TmЯ;Quality management systems — Requirements-Quatriшme щditionTnЯ8Quality Management Systems - Requirements-Fourth EditionToЯ8Quality Management Systems - Requirements-Fourth EditionTpЯ8Quality Management Systems - Requirements-Fourth EditionкqЯHygrothermal performance of building components and building elements - Internal surface temperature to avoid critical surface humidity and interstitial condensation - Calculation methods (ISO 13788:2001)TqЯЬ .8ErE hFrbpEr€ErˆErFrpErкrЯHygrothermal performance of builfing components and building elements - Internal surface temperature to avoid critical surface humidity and interstitial condensation - Calculation methods (ISO 13788:2001)TrЯЬ 08EПE hFПbpEП€EПˆEПFПpEПКsЯSterilization of health care products - Moist heat - Part 1: Requirements for the development, validation and routine control of a sterilization process for medical devicesTsЯЌ 28EћE hFћbpEћ€EћˆEћFњpEћpEћStЯMetallic Materials Properties Development and Standardization (MMPDS)TtЯE 48EыE hFыbpEы€EыˆEыFыpEыduЯStandard on Fire Department Occupational Safety and Health Program-TIA 02-1: 7/17/2003TuЯV 68EИ3E hFИ3bpEИ3€EИ3ˆEИ3FИ3pEИ3TvЯ;Quality management systems — Requirements-Quatriшme щditionШwЯSteel, Corrosion Resistant, Sheet and Strip 17Cr – 7.1Ni – 1.1Al Solution Heat Treated and Cold Rolled, Precipitation Hardenable 0.0015 to 0.050 Inch (0.038 to 1.27 mm) Nominal ThicknessTwЯК 98EыE hFыbpEы€EыˆEыFыpEыpEыTxЯ;Quality management systems — Requirements-Quatriшme щditionTyЯ;Quality management systems — Requirements-Quatriшme щdition‘zЯRoad Vehicles - Electrical Disturbance from Conduction and Coupling - Part 1: Definitions and General Considerations-Second EditionTzЯƒ =8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓ‘{ЯRoad Vehicles - Electrical Disturbance from Conduction and Coupling - Part 1: Definitions and General Considerations-Second EditionT{Яƒ ?8EИ3E hFИ3bpEИ3€EИ3ˆEИ3FИ3pEИ3pEИ3х|ЯRoad Vehicles - Electrical Disturbance by Conduction and Coupling - Part 2: Commercial Vehicles with Nominal 24 V Supply Voltage - Electrical Transient Conduction Blong Supply Lines Only First Edition-Second EditionT|Яз A8EИ3E hFИ3bpEИ3€EИ3ˆEИ3FИ3pEИ3pEИ3д}ЯRoad vehicles — Electrical disturbances from conduction and coupling — Part 3: Electrical transient transmission by capacitive and inductive coupling via lines other than supply lines-Second EditionT}ЯЦ C8EПE hFПbpEП€EПˆEПFПpEПЏ~ЯRoad vehicles — Electrical disturbances from conduction and coupling — Part 2: Electrical transient conduction along supply lines only AMENDMENT 1-Second EditionT~ЯЁ E8ErE hFrbpEr€ErˆErFrpEr•ЯFOTP-171 Attenuation by Substitution Measurement for Short-Length Multimode Graded-Index and Single Mode Optical Fiber Cable AssembliesTЯ‡ G8EИ3E hFИ3bpEИ3€EИ3ˆEИ3FИ3pEИ3pEИ3T€Я8Quality Management Systems - Requirements-Fourth Edition 1-Second EditjonT~ЯЁ E8ErE hFrbpEr€ErˆErFrpErЯ•ЯFOTP-171 Attenuation by Substitution Measurement for Short-Length Multimode Graded-Index and Single Mode Optical Fiber Cable AssembliesTЯ‡ G8EИ3E hFИ3bpEИ3€EИ3ˆEИ3FИ3pEИ3pEИ3фf0-%ќf0-%єш ›GВ^Џ[‡3Nњi„0мˆРlД` ЙџЋб}ЃOћЇSџŸKк †  С Z  Ѓ O ь ˜ 5 с G ѓ’>юšJіt Д`є PќЈTџЋV­YА`џM˜й1CЁ%KBР TЯ8Quality Management Systems - Requirements-Fourth EditionT‚Я;Quality management systems — Requirements-Quatriшme щdition–ƒЯEvaluation of Surface Contamination - Part 1: Beta-Emitters (Maximum Beta Energy Greater Than 0.15 MeV) and Alpha-Emitters First EditionTƒЯˆЁ8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3T„Я$Switchgear assemblies-Eighth EditionT…Я;Quality management systems — Requirements-Quatriшme щditiones_q†ЯHealth informatics — Electronic health record communication — Part 1: Reference model-FIrst EditionT†ЯcЁ8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3‡ЯHealth informatics Guidelines on data protection to facilitate trans-border flows of personal health information-First EditionT‡ЯЁ8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3gˆЯHealth informatics Electronic health record Definition, scope and context-First EditionTˆЯYЁ 8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3pEx3i‰ЯHealth informatics Requirements for an electronic health record architecture-First EditionT‰Я[Ё 8EjE hFjbpEj€EjˆEjFjpEj~ŠЯInformation technology Security techniques Code of pracvice for information security management-Second EditionTŠЯpЁ8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3c‹ЯISO 9000 COLLECTION 1-INCLUDES MOST CURRENT REVISIONS OF ISO 9000, ISO 9001, ISO 9004T‹ЯUЁ8EыE hFыbpEы€EыˆEыFыpEыTŒЯ8Quality Management Systems - Requirements-Fourth EditionvЯConformity Assessment - General Requirements for Bodies Operating Certification of Persons-Fjrst EditionTЯhЁ8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3TŽЯ%Plywood and Wood Fiber Sheet ProductsTЯ2Children's Playspaces and Equipment-Fourth EditionTЯ2Children’s playspaces and equipment-Fourth EditionT‘Я#Children’s playspaces and equipment-Fourth Editionl’ЯGraphical symbols — Test methods — Part 1: Methods for testing comrrehensibility-First EditionT’Я^Ё8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3l“ЯGeneral requirements for the competence of testing and calibration laboratories-Second editionT“Я^Ё8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3pEg3l”ЯGeneral requirements for the competence of testing and calibration laboratories-Second editionT”Я^Ё8Eъ3E hFъ3bpEъ3€Eъ3ˆEъ3Fъ3pEъ3m•ЯSevscrew-Hexagon Socket, Half-Dog Point, Corrosion-Resisting Steel, Passivated, UNC-3A-FSC 5305T•Я_Ё8Eg3E hFg3bpEg3€Eg3ˆEg3Fg3pEg3pEg3T–Я;Quality management systems — Requirements-Quatriшme щditiones_T—Я8Quality Management Systems - Requirements-Fourth EditionŘЯAcoustics - Determination of Sound Power Levels of Noise Sources Using Sound Intensity - Part 1: Measurement at Discrete Points First Edition (CEN EN ISO"9614-1: 1995)T˜ЯЇЁ#8EjE hFjbpEj€EjˆEjFjpEjpEjT™Я;Quality management systems — Requirements-Quatriшme щditiones_ЂšЯSterilization of medical devices Microbiological methods Part 1: Determination of a population of microorganisms on products TECHNICAL CORRIGENDUM 1TšЯ”Ё&8EћE hFћbpEћ€EћˆEћFћpEћ€›ЯMEDICAL ELECTRICAL EQUIPMENT – Part 1: General requirements for basic rafety and essential performance-Edition 3.0T›ЯrЁ(8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3lœЯGeneral requirements for the competence of testing and calibration laboratories-Second editionTœЯ^Ё*8EW3E hFW3bpEW3€EW3ˆEW3FW3pEW3lЯGeneral requirements for the competence of testing and calibration laboratories-Second editionTЯ^Ё,8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3 tžЯAntennas, Towers, and Antenna-Supporting Structures-Sixth Edition; Update No 1; Update 2: January 2006TžЯfЁ.8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3TŸЯ'Antennes, Pylones Et Supports DДAntennež ЯProficiency Testing by Interlaboratory Comparisions - Part 1: Development and Operation of Laboratory Proficiency Testing Schemes-Second EditionT ЯЁ18EПE hFПbpEП€EПˆEПFОpEП­ЁЯProficiency Testing by Interlaboratory Comparisions - Part 2: Selection and Use of Proficiency Testing Schemes by laboratory Accreditation Bodies-First EditionTЁЯŸЁ38EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3”ЂЯReaction to fire tests - Ignitability of building products subjected to direct impingement of flame - Part 2: Single-flame source testTЂЯ†Ё58EПE hFПbpEП€EПˆEПFПpEПpEПkЃЯPlastics - Film and sheeting - Determination of tear resistance - Part 1: Trouser tear methodTЃЯ]Ё78EW3E hFW3bpEW3€EW3ˆEW3FW3pEW3pEW3aЄЯEnvironmental management systems Requirements with guidance for use-Second EditionTЄЯSЁ98EjE hFjbpEj€EjˆEjFjpEjaЅЯEnvironmental management systems Requirements with guidance for use-Second EditionTЅЯSЁ;8EW3E hFW3brEW3€EW3ˆEW3FW3pEW3pEW3aІЯEnvironmental management systems Requirements with guidance for use-Second EditionTІЯSЁ=8E_3E hF_3bpE_3€E_3ˆE_3F_3pE_3pE_3TЇЯ8Quality Management Systems - Requirements-Fourth EditionTЈЯ;Quality management systems — Requirements-Quatriшme щditioncЉЯISO 9000 COLLECTION 1-INCLUDES MOST CURRENT REVISIONS OF ISO 9000, ISO 9001, ISO 9004TЉЯUЁA8EыE hFыbpEы€EыˆEыFыpEыcЊЯISO 9000 COLLECTION 1-INCLUDES MOST CURRENT REVISIONS OF ISO 9000, ISO 9001, ISO 9004TЊЯUЁC8EћE hFћbpEћ€EћˆEћFћpEћcЋЯISO 9000 COLLECTION 1-INCLUDES MOST CURRENT REVISIONS OF ISO 9000, ISO 9001, ISO 9004TЋЯUЁE8EЬ3E hFЬ3bpEЬ3€EЬ3ˆEЬ3FЬ3pEЬ3TЌЯHumidity Corrosion Test€?€?€?€?€?Ш­ЯSoil quality - Leaching procedures for subsequent chemical and ecotoxicological testing of soil and soil materials - Part 1: Batch test using a liquid to solid ratio of 2 l/kg dry matterT­ЯКЁH8EыE hFыbpEы€EыˆEыFыpEыpEы]ЎЯMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TЎЯOЁJ8EыE hFыbpEы€EыˆEыFыpEыpEыЏЯsЏЯEvaluation of Properties of Polymfric Materials-Second Edition; General Instruction No 1; Update No 2/kg dry matterT­ЯКЁH8EыE hFыbpEы€EыˆEыFыpEыpEыЎЯ]ЎЯMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000ЌЕ Иb Hп.la шŽ(pп.xп.0аnНѕЁMъ–3п|(д€ЫjЕaіЂК ЙЧsџЋ?ы+ЋWЕa X  А \ я › / л o  Џ [  Г_ •AэŠ6ИdћЇ@ь_ šFђžД`џP˜й0>Ђ'бй0$TЏЯeЁLƒ hFы€EыbzEыˆEыFыpEыpEыTАЯ;Quality management systems — Requirements-Quatriшme щditioneIжInformation technology — Coding of audio-visual objects — Part 1: Systems-Third EditionTIжWЂ8EЖLE hFЖLbpEЖL€EЖLˆEЖLFЖLpEЖL`EЖLTJж;Quality management systems — Requirements-Quatriшme щdition”KжInformation technology — Coding of audio-visual objects — Part 1: Systems AMENDMENT 1: Text profile and level indication-Third EditionTKж†Ђ8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3pEЫ3žLжInformation technology — Coding of audio-visual objects — Part 1: Systems AMENDMENT 2: 3D compression profile and level indication-Third EditionTLжЂ8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3pEЫ3ŽMжIneormation technology — Coding of audio-visual objects — Part 1: Systems AMENDMENT 3: JPEG 2000 support in MPEG-4-Third EditionTMж€Ђ 8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓTNж;Quality management systems — Requirements-Quatriшme щditionTOж;Quality management systems — Requirements-Quatriшme щditionTPж;Quality management systems — Requirements-Quatriшme щditionTQж;Quality management systems — Requirements-Quatriшme щditionTRж;Quality management systems — Requirements-Quatriшme щditionTSж;Quality management systems — Requirements-Quatriшme щditionE TTж*Electronic Records as Documentary EvidenceQuatriшme щditionE TUж*Procedure for Neutral Salt Spray Test-EngllVжGeneral requirements for the competence of testing and calibration laboratories-Second editionTVж^Ђ8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3TWж;Quality management systems — Requirements-Quatriшme щditionlXжGeneral requirements for the competence of testing and calibration laboratories-Second editionTXж^Ђ8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3ŸYжAgricultural and forestry tractors — Roll-over protective structures on narrow-track wheeled tractors — Part 1: Front-mounted ROPS-Second EditionTYж‘Ђ8Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3pEp3žZжAgricultural and forestry tractors — Roll-over protective structures on narrow-track wheeled tractors — Part 2: Rear-mounted ROPS-Second EditionTZжЂ8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3[жSafety of machinery — Safety distances to prevent hazard zones being reached by upper and lower limbs-First EditionT[жsЂ8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3 T\ж8Quality Management Systems - Requirements-Fourth EditionS]жMetallic Materials Properties Development and Standardization (MMPDS)T]жEЂ8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3pE^3ƒ^жInformation technology Security techniques Information security management systems Requirements-ISO/IEC 27001:2005T^жuЂ!8Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3pEp3m_жQuality Management Systems - Aermspace - Requirements-Technically Equivalent to AECMA prEN 9100T_ж_Ђ#8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3pE^3T`ж;Quality management systems — Requirements-Quatriшme щditionOaжStandard Test Methods for Rockwell Hardness of Metallic MaterialsTaжAЂ&8Ep3E hFp3bpEp3€Ep3ˆEp3Fp3pEp3pEp3Tbж*Electronic Records as Documentary Evidence`cжScrew, Pan Head Slotued Dovetail Recess, Full Thread Self-Locking Optional-Rev. 10TcжRЂ)8EыE hFыbpEы€EыˆEыFыpEыpEыTdж8Quality Management Systems - Requirements-Fourth Editionies_Teж8Quality Management Systems - Requirements-Fourth EditionTfж'Methods of Sampling and Testing CordagenceTgж8Quality Management Systems - Requirements-Fourth Editionies_whжGeneral Specification for Electrical/Electronic Components – Environmental/Durability-English; Revision GThжiЂ/8EќE hFќbpEќ€EќˆEќFќpEќˆiжGeometrical Product Specifications (GPS) - Indication of Surface Texture in Technical Product Documentation-Fourth EditionTiжzЂ18Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3’jжGuidelines for quality and/or environmental management systems auditing – U.S. Version with supplemental euidance added-Same as T853Tjж„Ђ38E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3pE^3Tkж8Quality Management Systems - Requirements-Fourth EditionTlжQuality Management Systems - Fundamentals and Vocabulary-Third EditionTlжFЂ68EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3TmжQuality Management Systems - Fundamentals and Vocabulary-Third EditionTmжFЂ88EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3TnжQuality Management Systems - Fundamentals and Vocabulary-Third EditionTnжFЂ:8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓToжQuality Management Systems - Fundamentals and Vocabulary-Third EditionToжFЂ<8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3Tpж;Quality management systems — Requirements-Quatriшme щdition€qжGraphical Symbols for Use on Equipment - Part 1: Overview amd Application-Edition 1.0; DATABASE SNAPSHOTS: 01/2007TqжrЂ?8EkE hFkbpEk€EkˆEkFkpEkYrжErgonomics — Manual handling — Part 2: Pushing and pulling-Premiшre щditionTrжKЂA8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3Tsж*Electronic Records as Documentary EvidenceВtжStandard Test Method for Determining Rate of Air Leakage Through Exterior Windows, Curtain Walls, and Eoors Under Specified Pressure Differences Across the SpecimenTtжЄЂD8EC4E hFC4bpEC4€EC4ˆEC4FC4pEC4Tuж:Compendium des matщriaux liants-Deuxieme Edition; Mise 1-3Tvж:Compendium des matщriaux liants-Deuxieme Edition; Mise 1-3Twж/Cementitious materials compendium-Third Editionn; Mise 1-3Txж/Cementitious materials compendium-Third EditionTyж/Cementitious materials compendium-Third Editionn; Mise 1-3Tzж;Quality management systems — Requirements-Quatriшme щditionъl{жStandard Test Methods for Direct Moisture Content Measurement of Wood and Wood- Base MaterialsT{ж^ЂL8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3T|ж8Quality Management Systems - Requirements-Fourth Edition-3}ж“}жHazardous Locations Guide for the Design, Testing, Construction, and Imstallation of Equipment in Explosive Atmospheres-Third Editionood- Base MaterialsT{ж^ЂL8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3T|ж8Quality Management Systems - Requirements-Fourth Edition-3ЋIѕ‰5с9х‘=‹7уŠ6ЖbКfОjТnˆ4ЌXс9х‘=н‰5ц’>б } њ І S џ Ћ * ж 8 ф E ё…1нqЩu!Эy%б}я›§ЉСmД`џQ˜йu+Ѓ*ФAL1T}ж…ЂOƒ hFx3€Ex3bzEx3ˆEx3Fx3pEx3~ж“~жHazardous Locations Guide for the Design, Testing, Construction, and Installation of Equipment in Explosive Atmospheres-Third EditionT~ж…Ѓ8EыE hFыbpEы€EыˆEыFыpEыTж8Quality Management Systems - Requirements-Fourth Edition€ж~€жSystems and software engineering — Requirements for designers and developers of user documentation-First EditionT€жpЃ8EќE hFќbpEќ€EќˆEќFќpEќTжToggle SwitchesT‚жToggle SwitchesTƒжToggle SwitchesT„жToggle SwitchesT…жToggle SwitchesT†ж;Quality management systems — Requirements-Quatriшme щditionT‡ж8Quality Management Systems - Requirements-Fourth EditionTˆж8Quality Management Systems - Requirements-Fourth EditionT‰ж8Quality Management Systems - Requirements-Fourth EditionionŠжˆŠжGeometrical Producu Specifications (GPS) - Indication of Surface Texture in Technical Product Documentation-Fourth EditionTŠжzЃ8EќE hFќbpEќ€EќˆEќFќpEќpEќ‹жa‹жEnvironmental management systems Requirements with guidance for use-Second EditionT‹жSЃ8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3pEУ3ŒжOŒжInformation and documentation - Work process analysis for recordsTŒжAЃ9E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3pE^3жVжMetallic Gaskets for Pipe Flanges Ring-Joint, Spiral-Wound, and JacketedTжHЃ8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3pEx3TŽж.Standard Practice for Liquid Penetrant TestingTж/Standard Practice for Magnetic Particle TestingTж:Linear Calibration Using Reference Materials First EditionT‘ж8Quality Management Systems - Requirements-Fourth EditionT’ж8Quality Management Systems - Requirements-Fourth EditionT“ж8Loading Tests on Overhead Line Structures-Second EditionT”ж8Quality Management Systems - Requirements-Fourth Edition•жs•жAutomotive fluid lubricants--Determination of low-temperature viscosity--Brookfield viscometer methodT•жeЃ8EсE hFсbpEс€EсˆEсFсpEсT–жAluminium Alloy Die Castings—жl—жGeneral requirements for the competence of testing and calibration laboratories-Second editionT—ж^Ѓ!8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3pEx3T˜ж8Quality Management Systems - Requirements-Fourth Edition™ж\™жStandard Test Method for Surface Burning Characteristics of Building MaterialsT™жNЃ$8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3Tšж8Quality Management Systems - Requirements-Fourth Editionies_T›жRING GASKET, BACK-UP, PTFEœжPœжRETAINER, PACKING BACKUP, CONTINUOUS RING, POLYTETRAFLUOROETHYLENETœжBЃ(8Eг3E hFг3bpEг3€Eг3ˆEг3Fг3pEг3ж`жInformation and Documentation - Records Management - Part 1: General-First EditionTжRЃ*8E^3E hF^3bpE^3€E^3ˆE^3F^3pE^3pE^3žжcžжInformation and Documentation - Records Management - Part 2: Guidelines-First EditionTžжUЃ,8Eг3E hFг3bpEг3€Eг3ˆEг3Fг3pEг3pEг3ŸжUŸжInformation technology - Coding of audio-visual objects - Part 3: AudioTŸжGЃ.8EсE hFсbpEс€EсˆEсFсpEсpEс жК жGraphical Symboms - Safety Colours and Safety Signs - Part 1: Design Principles for Safety Signs in Workplaces and Public Areas-First Edition; Corrected Version: 12/15/2003T жЌЃ08EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓЁжƒЁжGraphical symbols Safety colours and safety signs Part 2: Design principles for product safety labels-First EditionTЁжuЃ28EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓЂж`ЂжGraphical symbmls - Technical guidelines for the consideration of consumers' needsTЂжRЃ48EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3pEV3TЃж;Quality management systems — Requirements-Quatriшme щditionTЄж;Quality management systems — Requirements-Quatriшme щditionTЅж;Quality management systems — Requirements-Quatriшme щditionTІж8Quality Management Systems - Requirements-Fourth Editionies_TЇж2Grapiical Symbols for Use on Equipment-Edition 1.0TЈж2Graphical Symbols for Use on Equipment-Edition 1.0TЉж2Graphical Symbols for Use on Equipment-Edition 1.0TЊж8Quality Management Systems - Requirements-Fourth EditionЋжМЋжAMERICAN NATIONAL STANDARD FOR ARBORICULTURAL OPERATIONS - PRUNING, REPAIRING, MAINTAINING, AND REMOVING TREES, AND CUTTING BRUSH - SAFETY REQUIREMENTS-(Copyright Holder ISA)TЋжЎЃ>8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3ЌжМЌжAMERICAN NATIONAL STANDARD FOR ARBORICULTURAL OPERATIONS - PRUNING, REPAIRING, MAINTAINING, AND REMOVING TREES, AND CUTTING BRUSH - SAFETY REQUIREMENTS-(Copyright Holder ISA)TЌжЎЃ@8Ex3E hFx3bpEx3€Ex3ˆEx3Fx3pEx3pEx3­жМ­жAMERICAN NATIONAL STANDARD FOR ARBORICULTURAL OPERATIONS - PRUNING, REPAIRING, MAINTAINING, AND REMOVING TREES, AND CUTTING BRUSH - SAFETY REQUIREMENTS-(Copyright Holder ISA)T­жЎЃB8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3ЎжaЎжEnvironmental management systems Requirements with guidance for use-Second EditionTЎжSЃD8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3TЏж;Quality management systems — Requirements-Quatriшme щditionTАж8Quality Management Systems - Requirements-Fourth Editionies_БжhБжSolar Domestic Hot Water Systems (Liquid to Liquid Heat Transfer)-General Instruction No 1TБжZЃH8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3ВжTВжSeasonal Use Solar Domestic Hot Water Systems-General Instruction No 1TВжFЃJ8EќE hFќbpEќ€EќˆEќFќpEќTГж8Quality Management Systems - Requirements-Fourth EditionДжQДжProduct Safety Signq and Labels-Incorpotates Errata August 23, 2007TДжCЃM8EыE hFыbpEы€EыˆEыFыpEыTЕж;Quality management systems — Requirements-Quatriшme щditionTЖж;Quality management systems — Requirements-Quatriшme щditionзƒ/о|(дr ЈTŸ=cEу;ч“?ы—Cуўœт€+ЩfЄBђ<ш Œ * ж j  Д A п ‹ 7 у  ; ч“=лŒ*Щgп})е-й…1н‰ ЉUТ`џR˜й’иЄ,І‘Q6TЗж8Quality Management Systems - Requirements-Fourth EditionionQИжProduct Safety Signs and Labels-Incorpotates Errata August 23, 2007TИжCЄ8EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3pEЖ3aЙжEnvironmental management systems Requirements with guidance for use-Second EditionTЙжSЄ8EќE hFќbpEќ€EќˆEќFќpEќpEќaКжEnvironmental management systems Requirements with guidance for use-Second EditionTКжSЄ8EыE hFыbpEы€EыˆEыFыpEыpEыTЛж8Quality Management Systems - Requirements-Fourth EditionyМжAir quality Determination of the uncertainty of the time average of air quality measurements-First EditionTМжkЄ8EсE hFсbpEс€EсˆEсFсpEсpНжAir Quality -!Determination of Ozone in Ambient Air - Ultraviolet Photometric Method-First EditionTНжbЄ 8Eю3E hFю3bpEю3€Eю3ˆEю3Fю3pEю3pEю3™ОжAir Quality - Evaluation of the Suitability of a Measurement Pr4ocedure by Comparison with a Required Measurement Uncertainty-First EditionTОж‹Є 8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3TПж:Linear Calibration Using Reference Materials First EditionwРжVentilation for Acceptable Indoor Air Quality-Includes ANSI/ASHRAE Addenda listed in Appendix I; PC 11/08TРжiЄ8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3TСж8Quality Management Systems - Requirements-Fourth EditionkТжEnvironmental management - Environmental performance evaluation - Guidelines (ISO 14031:1999)TТж]Є8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3wУжWater Quality - Determination of Total Cyamide and Free Cyanide by Continuous Flow Analysis-First EditionTУжiЄ8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3pEV3^ФжColorfastness to Artificial Weathering-Replaced GME 60292, ISC-C93-001, STD 3159TФжPЄ8EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3TХж)Visual Evaluation of Automotive Trim-EnglTЦж>Protocol To Verify Performance of New Xenon Arc Test Apparatus{ЧжAccelerated Exposure of Automotive Interior Trim Components Using a Controlled Irradiance Xenon-Arc ApparatusTЧжmЄ8EсE hFсbpEс€EсˆEсFсpEсpEсUШжProcedure for Determining Fiber Degradation of Automotive Textiles-EnglTШжGЄ8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3PЩжProcedure for Determining Fiber Degradation of Automotive TextilesTЩжBЄ8EсE hFсbpEс€EсˆEсFсpEсpEсeЪжNatural Weathering Exposure Tests for Interior Trims/Materials-Engl; Replaces GME 60372TЪжWЄ 8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3TЫж@Artificial Weathering of Automotive Interior Trim Materials-EnglPЬжProcedure for Determining Fiber Degradation of Automotive TextilesTЬжBЄ#8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3pEУ3PЭжProcedure for Determining Fiber Degradation of Automotive TextilesTЭжBЄ%8EсE hFсbpEс€EсˆEсFсpEсpEсTЮж&Automotive Fabrics-English; Revision AXenon Arc Test ApparatusTЯж8Quality Management Systems - Requirements-Fourth EditionaratusaажEnvironmental management systems Requirements with guidance for use-Second EditionTажSЄ)8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3€бжGraphical Symbols for Use on Equipment - Part 1: Overview and Application-Edition 1.0; DATABASE SNAPSHOTS: 01/2007TбжrЄ+8Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3lвжGeneral requirements for the competence of testing and calibration laboratories-Second editionTвж^Є-8EсE hFсbpEс€EсˆEсFсpEсpEсlгжGeneral requirements for the competence of testing and calibration laboratories-Second editionTгж^Є/8EN3E hFN3bpEN3€EN3ˆEN3EN3pEN3pEN3lджGeneral requirements for the competence of testing and calibration laboratories-Second editionTдж^Є18EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3Tеж"Lighting for Exterior EnvironmentsTжж3Guide for Root Pass Welding of Pipe Without BackingitionaratusTзж3Guide for Root Pass Welding of Pipe Without BackingTиж8Quality Management Systems - Requirements-Fourth EditionaratusqйжInformation technology - Security techniques - Code of practice for information security managementTйжcЄ78EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3pEV3Tкж8Quality Management Systems - Requirements-Fourth EditionyлжGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TлжkЄ:8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3pEV1Tмж8Quality Management Systems - Requirements-Fourth EditionlнжGeneral requirements for the competence of testing and calibration laboratories-Second editionTнж^Є=8Eг3E hFг3bpEг3€Eг3ˆEг3Fг3pEг3lожGeneral requirements for the competence of testing and calibration laboratories-Second editionTож^Є?8Eг3E hFг3bpEг3€Eг3ˆEг3Fг3pEг3pEг3„пжGeneral requirements for uhe competence of testing and calibration laboratories TECHNICAL CORRIGENDUM 1-Second editionTпжvЄA8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3Tрж8Quality Management Systems - Requirements-Fourth Edition€?Tсж;Quality management systems — Requirements-Quatriшme щditiones_Tтж;Quality management systems — Requirements-Quatriшme щditionTуж;Quality management systems — Requirements-Quatriшme щditionTфж8Quality Management Systems - Requirements-Fourth EditionTхж8Quality Management Systems - Requirements-Fourth Edition`цжInformation and Documentation - Records Management - Part 1: General-First EditionTцжRЄI8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3`чжInformation and Documentation - Records Management - Part 1: General-First EditionTчжRЄK8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3`шжInformation and Documentation - Records Management - Part 1: General-First EditionTшжRЄM8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3`щжInformation and Documentation - Records Management - Part 1: General-First EditionTщжRЄO8EПE hFПbpEП€EПˆEПFПpEПpEПъжRъжInformation and documentation - Records management - Part 1: Generals Management - Part 1: General-First EditionTшжRЄM8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3щж`щжInformation and Documentation - Records Management - Part 1: General-First EditionTщжRЄO8EПE hFПbpEП€EПˆEПFПpEПpEП†$ФpМ\ЈTЌXА\и„ФXА7уЪv"ЮzКNњŽ:КfБ] Й e  С m  Д d  Л g ь ˜ D №’>ЧsД`щ•AЈTфУoКYД`џQ˜йdњЅ/6ApTъжDЄQƒ hFП€EПbzEПˆEПFПpEПpEПUыжInformation and documentation - Records management - Part 2: GuidelinesTыжGЅ8EыE hFыbpEы€EыˆEыFыpEыpEыUьжInformation and documentation - Records management - Part 2: GuidelinesTьжGЅ8EыE hFыbpEы€EыˆEыFыpEыpEыUэжInformation and documentation - Records management - Part 2: GuidelinesTэжGЅ8EV3E hFV3bpEV3€EV3ˆEV3FV3pEV3pEV3cюжInformation and Documentation - Records Management - Part 2: Guidelines-First EditionTюжUЅ8EыE hFыbpEы€EыˆEыFыpEыpEыTяж;Quality management systems — Requirements-Quatriшme щditionT№ж;Quality management systems — Requirements-Quatriшne щditionTёж8Quality Management Systems - Requirements-Fourth EditionionZђжGuideline on Durability in Buildings-General Instruction No 1; First EditionTђжLЅ 8Eг3E hFг3bpEг3€Eг3ˆEг3Fг3pEг3pEг3ZѓжGuideline on Durability in Buildings-General Instruction No 1; First EditionTѓжLЅ8EПE hFПbpEП€EПˆEПFПpEПpEПTєж7Minimum Design Loads for Buildings and Other RtructuresTѕж7Minimum Design Loads for Buildings and Other Structuresn€?Tіж>Screw, Self-Locking-Flat Fillister Head, Full Thread (Rev. 10)aїжScrew, Machine-Flat Fillister Head, Full Thread, Offset Cruciform-Rev. 11; FSC 5305TїжSЅ8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3ВјжScrew, Cap, Socket Head Undrilled and Drilled, Plain and Self-Locking Alloy Steel, Corrosion- Resistant Steel and Heat-Resistant Sveel, UNRC-3A and UNRC-2A (Rev. 9)TјжЄЅ8Eг3E hFг3bpEг3€Eг3ˆEг3Fг3pEг3pEг3`љжInformation and Documentation - Records Management - Part 1: General-First EditionTљжRЅ8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3cњжInformation and Documentation - Records Management - Part 2: Guidelines-First EditionTњжUЅ8EN3E hFN3bpEN3€EN3ˆEN3FN3pEN3pEN3bћжNon-Destructive Tfsting - Qualification and Certification of Personnel-ISO 9712:2005TћжTЅ8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3pEЫ3bќжNon-Destructive Testing - Qualification and Certification of Personnel-ISO 9712:2005TќжTЅ8EПE hFПbpEП€EПˆEПFПpEПpEПT§ж;Quality management systems — Requirements-Quatriшme щdition10)Tўж;Quality management systems — Requirements-Quatriшme щditiones_Tџж8Quality Management Systems - Requirements-Fourth EditionTз8Quality Management Systems - Requirements-Fourth Editionies_Tз8Quality Management Systems - Requirements-Fourth Editioniones_Tз8Quality Management Systems - Requirements-Fourth Editionies_VзRECESS-OFFSET CRUCIFORM RIBBED DIMENSIONS OF RECESS, GAGE AND DRIVER FORTзHЅ%8Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3Tз7Safety Standard for Portable Automotive Lifting Devices}зFOTP-80 IEC-60793-1-44 Optical Fibres – Part 1-44: Measurement Methods and Test Procedures – Cut-off WavelengthTзoЅ(8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3pEЫ3`зInformation and Documentation - Records Management - Part 1: General-First EditionTзRЅ*8EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3Tз8Quality Management Systems - Requirenents-Fourth EditioncзInformation and Documentation - Records Management - Part 2: Guidelines-First EditionTзUЅ-8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3pEУ3l зGeneral requirements for the competence of testing and calibration laboratories-Second editionT з^Ѕ/8EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3pEЖ3T з;Quality management systems — Requirements-Quatriшme щditionT з;Qualivy management systems — Requirements-Quatriшme щditionT з;Quality management systems — Requirements-Quatriшme щdition” зElectromagnetic compatibility (EMC) – Part 4-2: Testing and measurement techniques – Electrostatic discharge immunity test-Edition 2.0T з†Ѕ48Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3|зUL Standard for Safety Information Technology Equipment – Safety – Part 1: General Requirements-Second EditionTзnЅ68EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3pEЫ3‚зMicrobiology of food and animal feeding stuffs - Protocol for the validation of alternative methods (ISO 16140:2003)TзtЅ88Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3aзEnvironmental management systems Requirements with guidance for use-Second EditionTзSЅ:8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3pEУ3rзInformation and documentation - Fuidelines for the content, organization and presentation of indexesTзdЅ<8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3pEУ3Tз;Quality management systems — Requirements-Quatriшme щditiones_Tз8Quality Management Systems - Requirements-Fourth EditionTз@Occupational health and safety management systems - requirementsTз;Quality management systems — Requirements-Quatriшme щditionTз;Qualjty management systems — Requirements-Quatriшme щditionTз;Quality management systems — Requirements-Quatriшme щditionTз;Quality management systems — Requirements-Quatriшme щdition€?|зUL Standard for Safety Information Technology Equipment – Safety – Part 1: General Requirements-Second EditionTзnЅE8Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3|зUL Standard for Safety Information Technology Equipment – Safevy – Part 1: General Requirements-Second EditionTзnЅG8EћE hFћbpEћ€EћˆEћFћpEћTз8Quality Management Systems - Requirements-Fourth EditionёзGuidelines for quality and/or environmental management systems auditing-ISO 19011:2002; Supersedes SN EN ISO 14010:1997, SN EN ISO 14011:1997, SN EN ISO 14012:1997, SN EN 30011-1:1993, SN EN 30011-2:1993, and SN EN 30011-3:1993TзуЅJ8E04E hF04bpE06€E04ˆE04F04pE04fзMedical laboratories — Particular requirements for quality and competence-Second editionTзXЅL8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3|зUL Standard for Safety Information Technology Equipment – Safety – Part 1: General Requirements-Second EditionTзnЅN8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3Tз8Quality Management Systems - Requirements-Fourth EditionXЅL8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3з|зUL Standard for Safety Information Technology Equipment – Safety – Part 1: General Requirements-Second EditionTзnЅN8Ef3E hFf3bpEf3€Ef3ˆEf3Ff3pEf3pEf3ІRж‚Шзƒ/Г_у;ч“?ы—Cб}ШFђv"Ž:ц’>в~ЧsПBю š D № œ H є   L ј – B р Œ ) еu!oКfОjМbКfЏ[В] Д`џM˜йaІ1”bC!T з8Quality Management Systems - Requirements-Fourth EditionT!з8Quality Management Systems - Requirements-Fourth Edition "зPaints and Varnishes - Corrosion Protection of Steel Structures by Protective Paint Systems - Part 2: Classification of Environments-First EditionT"з’І8EЖ3E hFЖ3bpEЖ3€EЖ3ˆEЖ3FЖ3pEЖ3pEЖ3Њ#зPaints and Varnishes - Corrosion Protection of Steel Structures by Protective Paint Systems - Part 4: Types of Surface and Surface Preparation-First EditionT#зœІ8EX3E hFX3bpEX3€EX3ˆEX3FX3pEX3T$з8Quality Management Systems - Requirements-Fourth EditionЧ%зSoil quality — Avoidance test for determining the quality of soils and effects of chemicals on behaviour — Part 1: Test with earthworms (Eisenia fetida and Eisenia"andrei)-First EditionT%зЙІ8EX3E hFX3bpEX3€EX3ˆEX3FX3pEX3pEX3T&з8Quality Management Systems - Requirements-Fourth EditionT'з8Quality Management Systems - Requirements-Fourth EditionT(з (R) Pyrometryement Systems - Requirements-Fourth Editiono)зFood safety management systems Requirements for any organization in the food chain-First EditionT)зaІ 8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3ƒ*зSafety Requirements for Machining Centers and Automatic, Numerically Controlled Milling, Drilling and Boring MachinesT*зuІ8ELE hFLbpEL€ELˆELFLpELl+зSafety Requirements for Turning Centers and Automatic, Numerically Controlled Turning MachinesT+з^І8EћE hFћbpEћ€EћˆEћFћpEћpEћT,з;Quality management systems — Requirements-Qubtriшme щditiong-зStandard Specifications for Highway Bridges-Revision 17; Errata: 01/2003; Errata: 03/2005T-зYІ8E04E hF04bpE04€E04ˆE04F04pE04g.зStandard Specifications for Highway Bridges-Revision 17; Errata: 01/2003; Errata: 03/2005T.зYІ8E04E hF04bpE04€E04ˆE04F04pE04pE04g/зStandard Specifications for Highway Bridges-Revision 17; Errata: 01/2003; Errata: 03/2005T/зYІ8EћE hFћbpEћ€EћˆEћFћpEћpEћy0зGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005T0зkІ8E04E hF04bpE04€E04ˆE04F04pE04pE04y1зGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005T1зkІ8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3T2з8Quality Managfment Systems - Requirements-Fourth EditionT3з8Quality Management Systems - Requirements-Fourth EditionT4з8Quality Management Systems - Requirements-Fourth EditionT5зQuality Management Systems - Fundamentals and Vocabulary-Third EditionT5зFІ 8EУ3E hFУ3bpEУ3€EУ3ˆEУ3FУ3pEУ3T6зQuality Management Systems - Fundamentals and Vocabulary-Third EditionT6зFІ"8EћE hFћbpEћ€EћˆEћFћpEћpEћw7зAmerican National Standard for Machine Tools Performance Criteria for Safeguarding-Replaces ANSI B11.19T7зiІ$8EME hFMbpEM€EMˆEMFMpEM_8зSafety Requirements for Manual Turning Machines with or without Automatic ControlT8зQІ&8EME hFMbpEM€EMˆEMFMpEMpEMˆ9зSafety Requirements for Manual Milling, Drilling and Boring Machines with"or without Automatic Control-Replaces ANSI B11.8T9зzІ(8Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3T:з8Quality Management Systems - Requirements-Fourth EditionT;з8Quality Management Systems - Requirements-Fourth EditionT<з@Line Traps for A.C. Power Systems-Edition 2; Amendment 1 04-2002T=з4Coupling Capacitors and Capacitor Dividers-Edition 2nt 1 04-2002T>з9Coupling Devices for Pover Line Carrier Systems-Edition 1T?з8Quality Management Systems - Requirements-Fourth EditionT@з@Line Traps for A.C. Power Systems-Edition 2; Amendment 1 04-2002TAз@Line Traps for A.C. Power Systems-Edition 2; Amendment 1 04-2002TBз4Coupling Capacitors and Capacitor Dividers-Edition 2jCзGuidelines for Alphabetical Arrangement of Letters and Sorting of Numerals and Other SymbolsTCз\І38Eq3E hFq3bpEq3€Eq3ˆEq3Fq3pEq3pEq3oDзInformation technology — Security techniques — Information security risk management-First EditionTDзaІ58EJ4E hFJ4bpEJ4€EJ4ˆEJ4FJ4pEJ4pEJ4’EзIdentification cards Contactless integrated circuit(s) cards Vicinity cards Part 1: Physical characteristics-ISO/IEC 15693-1:2000TEз„І78EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓ”FзIdentification Carfs - Contactless Integrated Circuit Cards - Vicinity Cards - Part 2: Air Interface and Initialization-Second EditionTFз†І98E1LE hF1LbpE1L€E1LˆE1LF1LpE1LGзIdentification Cards - Contactless Integrated Circuit(s) Cards - Vicinity Cards - Part 3: Anticollision and Transmission Protocol-First EditionTGзІ;8EПE hFПbpEП€EПˆEПFПpEПpEП{HзThermal performance of buildings - Determination of air pfrmeability of buildings - Fan pressurization methodTHзmІ=8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3{IзThermal performance of buildings - Determination of air permeability of buildings - Fan pressurization methodTIзmІ?8E1LE hF1LbpE1L€E1LˆE1LF1LpE1LpE1LёJзPolyurethane Foam for Trim Pads-English; Replaces GMW15057, GMW15060, GM6291M, GME TM 581400, GME TM 582300, GME TM 580500, GME TM 589300, GME TM 601700, GNE TM 605500, GME TM 580300, GME TM 603200, GME TM 589800, GME TM 589900TJзуІA8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓTKз8Quality Management Systems - Requirements-Fourth EditionvLзSafety of machinery — Risk assessment — Part 2: Practical guidance and examples of methods-First EditionTLзhІD8EПE hFПbpEП€EПˆEПFПpEПTMз8Quality Management Systems - Requirements-Fourth EfitionTNз;Quality management systems — Requirements-Quatriшme щditionTOз;Quality management systems — Requirements-Quatriшme щditionTPз;Quality management systems — Requirements-Quatriшme щditionTQз;Quality management systems — Requirements-Quatriшme щditionTRз;Quality management systems — Requirements-Quatriшme щditionTSз;Quality management systems — Requirements-Quatriшme щditionщditionTPз;Quality management systems — Requirements-Quatriшme щditionTQз;Quality management systems — Requirements-Quatriшme щditionTRз;Quality management systems — Requirements-Quatriшme щditionчhА( Ч№ПЧБ] Еa Йeя›GV‡3ИdЧsп‹љЅ6тx$а|(д€,и„0ЈTѕЁ*ж ‚ . к † 2 о Š  Н D № ‰ 5 ЮzПkџЋ(дeНiNњІќЈД`џI˜йiЇ3Z0]TзRisk Management: Guideline for Decision-Makers-First Edition; Incorporates No 1TTзOЇ8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3jUз(R) Aerospace First Article Inspection Requirement-Technically Equivalent to AECMA prEN 9102TUз\Ї8EЦLE hFЦLbpEЦL€EЦLˆEЦLFЦLpEЦLTVз8Quality Management Systems - Requirements-Fourth EditionTWз;Quality management systems — Requirements-Quatriшme щdition?bXзStationary training equipment - Part 1: General safety requirements and test methodsTXзTЇ8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3TYз Safety Colors0€?€?Ccategories_ІZзGeneral Tolerances - Part 1: Tolerances for Linear and Angular Dimensions without Individual Tolerance Indications First Edition; (CEN EN 22768-1: 1993)TZз˜Ї 8EЖLE hFЖLbpEЖL€EЖLˆEЖLFЖLpEЖL›[зGeneral Tolerances - Part 2: Geometrical Tolerances for Features without Individual Tolerance Indications-First Edition; CEN EN 22768-2: 1993T[зЇ 8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3[\зSteels - Micrographic Determination of the Apparent Grain Size-Second EditionT\зMЇ 8E1LE hF1LbpE1L€E2LˆE1LF1LpE1LT]з3Paints and Varnishes - Cross-Cut Test-Third EditionT^з3Paints and Varnishes - Cross-Cut Test-Third Edition щdition?І_зGeneral Tolerances - Part 1: Tolerances for Linear and Angular Dimensions without Individual Tolerance Indications First Edition; (CEN EN 22768-1: 1993)T_з˜Ї8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓT`з3Paints and Varnishes - Cross-Cut Test-Third Editjon щdition?Taз3Paints and Varnishes - Cross-Cut Test-Third Edition щdition?SbзPaints and Varnishes - Determination of Film Thickness-Fourth EditionTbзEЇ8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓqcзCorrosion Tests in Artificial Atmospheres - Salt Spray Tests-Second Edition; Replaces ISO 7253:1996TcзcЇ8EF3E hFF3bpEF3€EF3ˆEF3FF3pEF3pEF3˜dзSteel and Iron - Sampling and Prepbration of Samples for the Determination of Chemical Composition-First Edition; Replaces ISO 377-2: 1989TdзŠЇ8EѓE hFѓbpEѓ€EѓˆEѓFѓpEѓpEѓ€eзHeat Treatment of Steel Raw Materials-Should Be Used Instead of MIL-H-6875, Which Was Cancelled on 2 February 1999TeзrЇ8EЖLE hFЖLbpEЖL€EЖLˆEЖLFЖLpEЖLpEЖLQfзCastings, Classification and Inspection of-Superseding AMS-STD-2175TfзCЇ8EЖLE hFЖLbpEЖL€EЖLˆEЖLFЖLpEЖLpEЖLTgз3Absorbent Material for Oils, Liquid Fuels and WaterfhзMedical laboratories — Particular requirements for quality and competence-Second editionThзXЇ 8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3giзMedical laboratories Particular requirements for quality and competence-Deuxiшme щditionTiзYЇ"8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3Vjз8Quality Management Systems - Requirements-Fourth EditionakзEnvironmental management systems Requirements with guidance for use-Second EditionTkзSЇ%8EЦLE hFЦLbpEЦL€EЦLˆEЦLFЦLpEЦLUnTlз8Quality Management Systems - Requirements-Fourth EditionTmз;Quality management systems — Requirements-Quatriшme щditionTnз:Quality Management - Guidelines for Training-First EditionZoзTesting of concrete Part 3: Making and curing test specimens-First Edition;ToзLЇ*8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3pзTesting of concrete - Part 4: Strength of hardened concrete-First Edition; Replaces ISO 4012:1978, ISO 4013:1978 and ISO 4108:1980Tpз‚Ї,8E1LE hF1LbpE1L€E1LˆE1LF1LpE1LgqзPAINT PERFORMANCE, PLASTIC SUBSTRATES, INTERIOR ***TO BE USED WITH FORD WSS-M99P1111-A***TqзYЇ.8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3frзSTANDARD REQUIREMENTS FOR PRODUCTION MATERIALS***TO BE USED WITH FORD WSS-M99P9999-A1***TrзXЇ08EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3pEЫ3Tsз;Quality management systems — Requirements-Quatriшme щditionTtз8Quality Management Systems - Requirements-Fourth EditionbuзNon-Destructive Testing - Qualification and Certification of Perronnel-ISO 9712:2005TuзTЇ48EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3pEЫ3ЁvзAccuracy (Trueness and Precision) of Measurement Methods and Results - Part 1: General Principles and Definitions-First Edition; Corrigendum 1-1998Tvз“Ї68Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3їwзAccuracy (Trueness and Precision) of Measurement Methods and Results - Part 2: Basic Method for the Determination of Repeatability and Reproducibilitz of a Standard Measurement Method First Edition;-Technical Corrigendum 1: 5/15/2002TwзщЇ88Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3пxзAccuracy (Trueness and Precision) of Measurement Methods and Results - Part 3: Intermediate Measures of the Precision of a Standard Measurement Method-First Edition; Replaces ISO 5725; Corrigendum 1 10/15/2001TxзбЇ:8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3РyзAccuracy (Trueness and Rrecision) of Measurement Methods and Results - Part 4: Basic Methods for the Determination of the Trueness of a Standard Measurement Method First Edition;TyзВЇ<8Ey3E hFy3bpEy3€Ey3ˆEy3Fy3pEy3pEy3рzзAccuracy (Trueness and Precision) of Measurement Methods and Results - Part 5: Alternative Methods for the Determination of the Precision of a Standard Measurement Method-First Edition; Corrigendum 1: 8/15/2005TzзвЇ>8EЫ3E hFЫ3bpEЫ3€EЫ3ˆEЫ3FЫ3pEЫ3pEЫ3К{зAccuracy (Trueness and Precision) of Measurement Methods and Results - Part 6: Use in Practice of Accuracy Values-First Edition; Replaces ISO 5725; Corrigendum 1:10/15/2001T{зЌЇ@8ELE hFLbpEL€ELˆELFLpELn|зHealth informatics — Information security management in health using ISO/IEC 27002-First EditionT|з`ЇB8E04E hF04bpE04€E04ˆE04F04pE04]}зRisk Management: Guideline for Decision-Makers-First Edition; Incorporates No 1T}зOЇD8EђE hFђbpEђ€EђˆEђFђpEђ‡~зTechnical drawings Indication of dimensions and tolerances Part 1: General principles-First Edition; Supersedes ISO 129T~зyЇF8E04E hF04bpE04€E04ˆE04F04pE04pE04з‡зTechnical drawings Indication of dimensions and tolerances Part 1: General principles-First Edition: Supersedes ISO 129~з‡~зTechnical drawings Indication of dimensions and tolerances Part 1: General principles-First Edition; Supersedes ISO 129T~зyЇF8E04E hF04bpE04€E04ˆE04F04pE04pE04Аv@аFSP.y_№? ћo№?Œ*ЃOђž0м"Ююšк†ЇS\gБ] ЕOћ”@А\ЎZВQ§ Љ B ю ˆ 4 р  ; Л g Я { ЖcЛgСmХj{'-йw#Я{Н`џM˜й‚ђЈ.R“АTC{qпF…Ј Ј|Бд=PD{Financial services UNIversal Financial Industry message scheme Part 4: ISO 20022 XML design rules-First EditionTD{qЈЈˆЈ Ј|Бд=PE{Financial services UNIversal Financial Industry message scheme Part 4: ISO 20022 XML design rules-First EditionTE{qЈЈŠЈ Ј|Б)д=PF{Financial services UNIversal Financial Industry message scheme Part 4: ISO 20022 XML design rules-First EditionTF{qЈЈŒЈ Ј|Б)д=PG{Financial services UNIversal Financial Industry message scheme Part 4: ISO 20022 XML design rules-First EditionTG{qЈЈЈ Ј|Б)д=PH{Financial services UNIversal Financial Industry message scheme Part 4: ISO 20022 XML design rules-First EditionTH{qЈ ЈЈ Ј|Б)д=P]I{Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TI{OЈ Ј–Ј Ј|Бд=P]J{Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TJ{OЈ Ј™Ј Ј|Бд=PЪK{Financial services UNIversal Financial Industry message scheme Part 1: Overall methodology and format specifications for inputs to and outputs from the ISO 20022 Repository-First EditionTK{МЈЈŸЈ Ј|Бд=Po]{Food safety management systems Requirements for any organization in the food chain-ISO 22000:2005T]{aЈЈХЈ Ј|Бд=Pl^{General requirements for the competence of testing and calibration laboratories-Second editionT^{^ЈЈЫЈ Ј|Б)д=PO_{FIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderT_{AЈЈЯЈ Ј|Бд=PT`{)Standard Test Methods for Foot ProtectionЈ!H0ВКЉ@ Ua{Standard Specification for Performanae Requirements for Foot ProtectionTa{GЈЈеЈ Ј|Бд=PTb{1Standard Requirements for Instrument TransformersВD0ВКЉ@` Tc{1Dimensional Tolerances for Aluminum Mill Products.TGУB4В)КЉ@d{Medical devices Quality management systems Guidance on the application of ISO 13485:2003-First Edition; Replaces ISO 14969:1999Td{ЈЈшЈ Ј|Б)д=QWe{Geographic Information - Spatial Referencing by Coordinates-First EditionTe{IЈЈьЈ Ј|Бд=PWf{Geographic Information - Spatial Referencing by Coordinates-First EditionTf{IЈ ЈюЈ Ј|Бд=PWg{Geographic Information - Spatial Referencing by Coordinates-First EditionTg{IЈ"Ј№Ј Ј|Бд=Pah{Environmental management systems Requirements with guidance for use-Second EditionTh{SЈ$ЈєЈ Ј|Бд=Pai{Environmental management systems Requirements with guidance for use-Second EditionTi{SЈ&ЈіЈ Ј|Бд=PЪj{Standard Specification for Steel, Sheet, Cold-Rolled, Carbon, Structural, High-Strength Low-Alloy, High-Strength Low-Alloy with Improued Formability, Solution Hardened, and Bake HardenableTj{МЈ(ЈљЈ Ј|Б)д=P†k{Information technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)Tk{xЈ*Ј§Ј Ј|Бд=P†l{Information technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)Tl{xЈ,ЈџЈ Ј|Бд=PTm{<A DTV Profile for Uncompressed High Speed Digital Interfaces @Tn{<A DTV Profile for Uncompressed High Speed Digital Interfacesno{Medical devices Quality management systems Requirements for regulatory purposes-Second EditionTo{`Ј0Ј Ј Ј|Б)д=Pmp{Quality management systems Guidelines for the application of ISO 9001:2010 in local governmentTp{_Ј2ЈЈ Ј|Бд=Pqq{Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994Tq{cЈ4ЈЈ Ј|Бд=Pqr{Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994Tr{cЈ6ЈЈ Ј|Б)д=Pms{Quality management systems Guidelines for the application of ISO 9001:2000 in local governmentTs{_Ј8ЈЈ Ј|Б)д=PTt{1Guide for the Nondestructive Examination of Weldsѓ;H0В)КЉ@€ Tu{)Guide for the Visual Examination of Weldsof Weldsѓ;H0В)КЉ@€ Tv{+Standard Guide for Radiographic Examination Weldsѓ;H0В)КЉ@€ Tw{>Standard Test Method for Radiographic Examination of WeldmemtsTx{Ice Hockey Pucks-Second Edition; General Instruction No 1; Update No 2Tx{FЈ>Ј.Ј Ј|Б)д=PTy{Ice Hockey Pucks-Second Edition; General Instruction No 1; Update No 2Ty{FЈ@Ј0Ј Ј|Б)д=Ptz{Rubber, vulcanized or thermoplastic - Determination of tensile stress-strain properties-Fourth EditionTz{fЈBЈ9Ј Ј|Бд=Pt{{Rubber, vulcanized or thermoplastic - Determination of tensile stress-strain properties-Fourth EditionT{{fЈDЈ;Ј Ј|Бд=Pt|{Rubber, vulcanized or thermoplastic - Determination of tensile stress-strain properties-Fourth EditionT|{fЈFЈ=Ј Ј|Бд=Pœ}{Rubber, Vulcanized or Thermoplastic - Determination of Hardness (Hardmess Between 10 IRHD and 100 IRHD)-Third Edition; Amendment 1: 08-15-1999T}{ŽЈHЈ?Ј Ј|Б)д=Pe~{Plastics - Determination of Flexural Properties-Fourth Edition; Amendment 1: 02/15/2004T~{WЈJЈAЈ Ј|Б)д=P{{Plastics - Determination of Charpy Impact Properties - Part 1: Non-Instrumented Impact Test-First Edition; Amendment 1: 7/15/2005ndment 1: 09-15-1999T}{ŽЈHЈ?Ј Ј|Б)д=P~{e~{Plastics - Determination of Flexural Properties-Fourth Edition; Amendment 1: 02/15/2004T~{WЈJЈAЈ Ј|Б)д=PЛ_1еЇyKяС“e7 л­Q#ѕЧ™k=сГ…W)cœHЌXфШTЌXА\Д`ѓŸ.кiЈTц’>ъdŠ6lЗcЎ W  Ќ X  ­  Ъ v " Э y % ж‚ТSџ5с„0гЌ-йZ‡3Д`џM˜й]Љ/>ITƒ{…оHLЉ Љ|Б)д=PЦ„{Polyethylene PE 32 and PE 40 pipes for irrigation laterals Susceptibility to environmental stress cracking induced by insert-type fittings Test method and requirements-Second EditionT„{ИЉЉOЉ Љ|Б)д=P™…{CLEANROOMS AND ASSOCIATED CONTROLLED ENVIRONMENTS SET-INCLUDES: ISO 14644-1, ISO 14644-2, ISO DIS 14644-3, ISO 14644-4, AND ISO DIS 14644-5T…{‹ЉЉSЉ Љ|Б)д=Pq†{Rubber and plastics machines - Injection moulding machines - Safety requirements-(AMENDS DS/EN 201)T†{cЉЉWЉ Љ|Бд=P^‡{Rubber and plastics machines - Injection moulding machines - Safety requirementsT‡{PЉЉYЉ Љ|Б)д=PTˆ{1Alloy and Temper Designation Systems for Aluminumˆ‰{Welding Consumables - Test Methods Part 1: Test Piece for All-Weld Metal Test Specimens in Steel, Nickel and Nickel AlloysT‰{zЉ ЉdЉ Љ|Бд=PЎŠ{Welding consumables Test methods and quality requirements Part 1: Primary methods and conformity assessment of consumables for steel, nickel and nickel alloysTŠ{ Љ ЉfЉ Љ|Бд=PT‹{1Alloy and Temper Designation Systems for Aluminum’KE0В)КЉ@` TŒ{1Alloy and Temper Designation Systems for Aluminum’KE0В)КЉ@` T{1Alloy and Temper Designation Systems for Aluminum’/E0ВКЉ@` TŽ{1Alloy and Temper Designation Systems for Aluminum’KE0В)КЉ@` T{1Alloy and Temper Designation Systems for Aluminums+H0В)КЉ@а T{1Alloy and Temper Designation Systems for Aluminums+H0В)КЉ@а T‘{1Alloy and Temper Designation Systems for Aluminums+H0В)КЉ@а T’{1Alloy and Temper Designation Systems for Aluminum’/E0ВКЉ@` T“{1Alloy and Temper Designation Systems for Aluminum’/E0ВКЉ@` T”{1Alloy and Temper Designation Systems for Aluminum’/E0ВКЉ@` T•{1Alloy and Temper Designation Systems for Aluminum’/E0ВКЉ@` t–{Rubber, vulcanized or thermoplastic - Determination of tensile stress-strain properties-Fourth EditionT–{fЉЉ‰Љ Љ|Бд=Pt—{Rubber, vulcanized or thermoplastic - Determination of tensile stress-strain properties-Fourth EditionT—{fЉЉЉ Љ|Бд=Pt˜{Rubber, vulcanized or thermoplastic - Determination of tensile stress-strain properties-Fourth EditionT˜{fЉЉ‘Љ Љ|Бд=Pt™{Rubber, vulcanized or thermoplastic - Determination of tensile stress-strain properties-Fourth EditionT™{fЉЉ•Љ Љ|Б)д=Ptš{Rubber, vulcanized or thermoplastic - Determination of tensile stress-strain properties-Fourth EditionTš{fЉ!Љ—Љ Љ|Б)д=Pt›{Rubber, vulcanized or thermoplastic - Determination of tensile stress-strain properties-Fourth EditionT›{fЉ#ЉšЉ Љ|Б)д=Ptœ{Rubber, vulcanized or thermoplastic - Determination of tensile stress-strain properties-Fourth EditionTœ{fЉ%ЉžЉ Љ|Б)д=Pt{Rubber, vulcanized or thermoplastic - Determination of tensile stress-strain properties-Fourth EditionT{fЉ'ЉЂЉ Љ|Бд=Ptž{Rubber, vulcanized or thermoplastic - Determination of tensile stress-strain properties-Fourth EditionTž{fЉ)ЉІЉ Љ|Бд=PfŸ{Graphical symbols - Technical guidelines for the consideration of consumers´ needsTŸ{XЉ+ЉЎЉ Љ|Б)д=Pf {Graphical symbols - Technical guidelines for the consideration of consumers´ needsT {XЉ-ЉАЉ Љ|Б)д=PlЁ{General requirements for the competence of testing and calibration laboratories-Second editionTЁ{^Љ/ЉДЉ Љ|Б)д=P[Ђ{Safety Requirements for Melting and Pouring of Metals in the Foundry IndustryTЂ{MЉ1ЉКЉ Љ|Бд=P…Ѓ{Documemtation - Methods for Examining Documents, Determining Their Subjects, and Selecting Indexing Terms First EditionTЃ{wЉ3ЉОЉ Љ|Б)д=PTЄ{4Welding Inspection Technology Wookbook-Third Edition0ВКЉ@` €Ѕ{Insert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340TЅ{rЉ6ЉШЉ Љ|Бд=P€І{Inseru, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340TІ{rЉ8ЉЪЉ Љ|Бд=PlИ{General requirements for the competence of testing and calibration laboratories-Second editionTИ{^Љ:ЉуЉ Љ|Б)д=PgЙ{Tourist activities. Quality of the tourist welcome facilities for the "Campagne Bonjour".TЙ{YЉ<ЉшЉ Љ|Бд=PlК{General requirements for the competence of testing and calibration laboratories-Second editionTК{^Љ>ЉьЉ Љ|Бд=PlЛ{General requirements for the competence of testing and calibration laboratories-Second editionTЛ{^Љ@ЉюЉ Љ|Бд=PlМ{General requirements for the competence of testing and!calibration laboratories-Second editionTМ{^ЉBЉ№Љ Љ|Бд=PlН{General requirements for the competence of testing and calibration laboratories-Second editionTН{^ЉDЉђЉ Љ|Б)д=P{О{Measurement Management Systems - Requirements for Measurement Processes and Measuring Equipment-First EditionTО{mЉFЉіЉ Љ|Б)д=P{П{Measurement Management Systems - Requirements for Measurement Processes and Measuring Equipment-First EditionTП{mЉHЉјЉ Љ|Б)д=P†Р{Information technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)TР{xЉJЉЉ Љ|Б)д=PС{œС{Road vehicles Diagnostics on Controller Area Neuworks (CAN) Part 3: Implementation of unified diagnostic services (UDS on CAN)-First EditionЉ Љ|Б)д=PР{†Р{Information technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)TР{xЉJЉЉ Љ|Б)д=PС_й… Ж;ч{'ЛgћЇ;ч€,Рlь˜Фpы—<ш|(ТnД@ьx$А\ш ” Ь X   < Ш t Ќ X  А\Д` Иdb†2о€,ЛgЮzД`џM˜йlЊ1JTС{ŽЉLЊ Њ|Бд=P~Т{Information technology Security techniques Code of practice for information security management-Second EditionTТ{pЊЊ Њ Њ|Бд=PdУ{Medical laboratories Particular requirements for quality and competence-First EditionTУ{VЊЊЊ Њ|Бд=PФђ{Single-use medical examination gloves Part 1: Specification for gloves made from rubber latex or rubber solution-First Edition; Supersedes ISO 11193: 1994; Corrigendum 1: 06/15/2005Tђ{ЖЊЊЄЊ Њ|Бд=PSѓ{Computer-Aided Design Drafting (Buildings)-General Instruction No 1-2Tѓ{EЊЊЋЊ Њ|Б!д=PVє{1Dimensional Tolerances for Aluminum Mill Products2@I0ВКЉ@` eѕ{Carrier Safety Management Systems-First Edition; General Instruction No 1; Update No. 2Tѕ{WЊ ЊЕЊ Њ|Бд=Pbі{Standard Reference Photographs for Magnetic Particle Indications on Ferrous CastingsTі{TЊ ЊПЊ Њ|Бд=Pqї{Quality Management Systems - Requirements-Third Efition; Supersedes ISO 9002:1994 and ISO 9003:1994Tї{cЊЊУЊ Њ|Бд=PTј{2Safeguarding of machinery-Second Edition; update 1I0ВКЉ@№ Tљ{2Safeguarding of machinery-Second Edition; update 1I0ВКЉ@№ Xњ{Polyvinyl Chloride Roofing and Waterproofing Membrane-Supersedes 37-GP-54MTњ{JЊЊЮЊ Њ|Бд=Paћ{Environmental management"systems Requirements with guidance for use-Second EditionTћ{SЊЊгЊ Њ|Б!д=Pnќ{Medical devices Quality management systems Requirements for regulatory purposes-Second EditionTќ{`ЊЊзЊ Њ|Б!д=Pь§{Financial Transaction Card Originated Messages - Interchange Message Specifications Second Edition; (CEN EN ISO 8583: 1995)-Second Edition; CEN EN ISO 8583 :1995: Technical Corrigendum 1: 12/15/1999; Replaced by ISO 8583-1T§{оЊЊмЊ Њ|Бд=P‰ŠMedical Electrical Equipment Part 1: General Requirements for Safety-Incorporates Corrigendum July 1994; Includes Amendments A1: 1993, A11: 1993, A12: 1993, A2: 1995 and A13: 1996; IEC 601-1: 1988 + A1: 1991 + A2: 1995 + Corrigendum 1995, ModifiedT‰ŠїЊЊсЊ Њ|Бхд=PfŠŠStandard"for Low Temperature Vents Type L-Amended February, 1992; Amended February, 1994TŠŠXЊЊщЊ Њ|Бхд=Pf‹ŠStandard for Low Temperature Vents Type L-Amended February, 1992; Amended February, 1994T‹ŠXЊЊыЊ Њ|Бхд=P]ŒŠMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TŒŠOЊ ЊяЊ Њ|Бхд=P]ŠMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TŠOЊ"ЊёЊ Њ|Бхд=PVŽŠNAS Certification & Qualification of Nondestructive Test Personnel-REV 2TŽŠHЊ$ЊљЊ Њ|Бхд=PTŠIce Hockey Pucks-Second Edition; General Instruction No 1; Update No 2TŠFЊ&ЊўЊ Њ|Бхд=PTŠIce Hockey Pucks-Second Edition; General Instruction No 1; Update No 2TŠFЊ(ЊЊ Њ|Бхд=Pq‘ŠQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T‘ŠcЊ*ЊЊ Њ|Бћд=PR’ŠPaper Toilet Tissue For Institutional Use-Amendment 1: November 1996T’ŠDЊ,Њ Њ Њ|Бћд=PRЄŠPaper Toilet Tissue For Institutional Use-Amendment 1: November 1996TЄŠDЊ.Њ%Њ Њ|Бћд=PRЅŠPaper Toilet Tissue For Institutional Use-Amendment 1: November 1996TЅŠDЊ0Њ'Њ Њ|Бћд=PRІŠPaper Toilet Tissue For Institutional Use-Amendment 1: November 1996TІŠDЊ2Њ)Њ Њ|Бћд=PRЇŠPaper Toilet Tissue For Institutional Use-Amendment 1: November 1996TЇŠDЊ4Њ+Њ Њ|Бћд=PRЈŠPaper Toilet Tissue For Institutional Use-Amendment 1: November 1996TЈŠDЊ6Њ-Њ Њ|Бћд=PRЉŠPaper Toilet Tissue For Institutional Use-Amendment 1: November 1996TЉŠDЊ8Њ/Њ Њ|Бћд=PRЊŠPaper Toilet Tissue For Institutional Use-Amendment 1: November 1996TЊŠDЊ:Њ0Њ Њ|Бћд=PRЋŠPaper Toilet Tissue For Institutional Use-Amendment 1: November 1996TЋŠDЊ<Њ2Њ Њ|Бхд=PTЌŠ"Paper Towels for Institutional Usel­ŠGeneral requirements for the competence of testing and calibration laboravories-Second editionT­Š^Њ?Њ:Њ Њ|Бћд=PlЎŠGeneral requirements for the competence of testing and calibration laboratories-Second editionTЎŠ^ЊAЊ>Њ Њ|Бћд=P~ЏŠInformation technology Security techniques Code of practice for information security management-Second EditionTЏŠpЊCЊCЊ Њ|Бћд=P—АŠTissue paper and tissue products Part 4: Determination of tensile strength, stretch at break and tensile energy absorption-First EditionTАŠ‰ЊEЊGЊ Њ|Бћд=P—БŠTissue paper and tissue products Part 4: Determination of tensile strength, stretch at break and tensile energy absorption-First EditionTБŠ‰ЊGЊIЊ Њ|Бћд=PСВŠPlastics - Determination of Tensine Properties - Part 3: Test Conditions for Films and Sheets-First Edition; Technical Corrigendum 1:06-15-1998; Technical Corrigendum 2:04-15-2001TВŠГЊIЊJЊ Њ|Бхд=PГŠСГŠPlastics - Determination of Tensile Properties - Part 3: Test Conditions for Films and Sheets-First Edition; Technical Corrigendum 1:06-15-1998; Technical Corrigendum 2:04-15-2001TГŠГЊKЊMЊ Њ|Бхд=Pitions for Films and Sheets-First Edition; Technical Corrigendum 1:06-15-1998; Technical Corrigendum 2:04-15-2001TВŠГЊIЊJЊ Њ|Бхд=PT&јЪœn@фЖˆZ,ўаЂtFъМŽ`2жЈzL№Т”f8 мЎ€R$іШšl>тД†X*ќЮ rDшКŒ^0дІxJюР’d6Дѓ‘а|х‘њІ(дhЈTЎZДbМhТpЪv$а~*ЙeНiПkК ] Ѓ O щ •  < P ќŽ:й…-й…1Рl ЖQ§ЉV>ъ†2Д`џI˜йˆєЋ1‹Ю  dФ{Medical laboratories Particular requirements for quality and competence-First EditionTФ{VЋЋЋ Ћ|Б!д=P€Х{Basic Environmental Testing Procedures Part 2: Tests- Test Ka: Salt Mist-Third Edition; Corrigendum: December 1999TХ{rЋЋЋ Ћ|Бд=PlЦ{General requirements for the competence of testing and calibration laboratories-Second editionTЦ{^ЋЋЋ Ћ|Бд=PTЧ{1Dimensional Tolerances for Aluminum Mill Products2G0ВКЉ@ †Ш{Medical Devices - Risk Management - Part 1: Application of Risk Analysis-Edition 1; Identical to ISO 14971-1; AMD 1:2003TШ{xЋЋ'Ћ Ћ|Бд=PwЩ{Medical Devices - Applibation of Risk Management to Medical Devices-First Edition; Amendment 1: 3/01/2003TЩ{iЋ Ћ+Ћ Ћ|Бд=PnЪ{Medical devices Quality management systems Requirements for regulatory purposes-Second EditionTЪ{`Ћ Ћ-Ћ Ћ|Бд=PoЫ{Food safety management systems Requirements for any organization in the food chain-First EditionTЫ{aЋ Ћ1Ћ Ћ|Б!д=PXЬ{Rubber, Vulcanized - Determination of the Effect of Liquids-Fourth EditionTЬ{JЋЋ5Ћ Ћ|Бд=PXЭ{Rubber, Vulcanized - Determination of the Effect of Liquids-Fourth EditionTЭ{JЋЋ9Ћ Ћ|Бд=P€Ю{Insert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5240TЮ{rЋЋ>Ћ Ћ|Б!д=PyЯ{Energy Performance, Water Consumption, and Capacity of Household Clothes Washers-Fifth Edition; Update No 1TЯ{kЋЋKЋ Ћ|Бд=Plа{General requirements for the competence of testing and calibration laboratories-Second editionTа{^ЋЋOЋ Ћ|Б!д=Psб{Environmental Nanagement Systems - Specification with Guidance for Use-ISO 14001:2004; Second EditionTб{eЋЋWЋ Ћ|Бд=Pmв{Statistical methods for use in proficiency testing by interlaboratory comparisons-First EditionTв{_ЋЋ\Ћ Ћ|Бд=Plг{General requirements for the competence of testing and calibration laboratories-Second editionTг{^ЋЊ^Ћ Ћ|Бд=Plд{General requirements for the competence of testing and calibration laboratories-Second editionTд{^ЋЋ`Ћ Ћ|Бд=PTе{;INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-10th EditionH4В†ж{Conformity assessment - Vocabulary and general principles (ISO/IEC 17000:2004); Trilingual version EN ISO/IEC 17000:2004Tж{xЋ"ЋdЋ Ћ|Бд=P†з{Conformity assessment - Vocabulary and general principles (ISO/IEC 17000:2004); Trilingual version EN ISO/IEC 17000:2004Tз{xЋ$ЋfЋ Ћ|Бд=PŸи{Standard Guide for Optimizing, Controlling and Reporting Test Method Uncertainties from Multiple Workstations in the Same Laboratory OrganizationTи{‘Ћ&ЋgЋ Ћ|Бд=P]й{Anaesthetic"and respiratory equipment - Compatibility with oxygen-First EditionTй{OЋ(ЋkЋ Ћ|Б!д=P˜к{Industrial Valves - Part-Turn Actuator Attachment-First Edition; Cancels and Replaces ISO 5211-1:1977, ISO 5211-2:1979 and ISO 5211-3:1982Tк{ŠЋ*ЋqЋ Ћ|Б!д=P˜л{Industrial Valves - Part-Turn Actuator Attachment-First Edition; Cancels and Replaces ISO 5211-1:1977, ISO 5212-2:1979 and ISO 5211-3:1982Tл{ŠЋ,ЋsЋ Ћ|Бд=PTм{@Quality Assurance Requirements for Nuclear Facility ApplicationsБн{Identification Cards - Contactless Integrated Circuit(s) Cards - Vicinity Cards - Part 2: Air Interface and Initialization-First Edition; Corrigendum 1: 10/15/2001Tн{ЃЋ/Ћ|Ћ Ћ|Б!д=PQо{Bank Cards - Magnetic Stripe Data Content"for Track 3-Third EditionTо{CЋ1ЋЋ Ћ|Б!д=Pƒп{Information Technology - Software Life Cycle Processes-First Edition; Amendment 1: 5/01/2002; Amendment 2: 11/01/2004Tп{uЋ3Ћ…Ћ Ћ|Бд=PTр{7Quality Management Systems - Requirements-Third EditionаВTДŠ1Emergency Preparedness and Response-Third EditionЮЕŠNicken/Cadmium Rechargeable Cells and Batteries for Electric Road Vehicle Propulsion Applications - Part 1: Dynamic Discharge Performance Test (DDPT) and Dynamic Endurance Test (DET)-Edition 1TЕŠРЋ7Ћ\Ћ Ћ|Бiд=PЮЖŠNickel/Cadmium Rechargeable Cells and Batteries for Electric Road Vehicle Propulsion Applications - Part 1: Dynamic Discharge Performance Test (DDPT) and Dynamic Endurance Test (DET)-Edition 1TЖŠРЋ9Ћ^Ћ Ћ|Бiд=PЗŠPlastics and Ebonite - Determination of Indentation Hardness by Means of a Durometer (Shore Hardness)-Third EditionTЗŠsЋ;ЋaЋ Ћ|Бхд=PtИŠHearing Aids Part 0: Measurement of Electroacoustical Characteristics-Second Edition; Amendment 1/1994TИŠfЋ=ЋeЋ Ћ|Бћд=PtЙŠHearing Aids Part 0: Measurement of Flectroacoustical Characteristics-Second Edition; Amendment 1/1994TЙŠfЋ?ЋgЋ Ћ|Бћд=PTКŠ,Specification of Hearing Aid Characteristics@@nF0“'C0ВхКЉ@ˆ lЛŠGeneral requirements for the competence of testing and calibration laboratories-Second editionTЛŠ^ЋBЋnЋ Ћ|Бiд=PmМŠPlastics - Film and Sheeting - Determination of Thickness by Mechanical Rcanning Second EditionTМŠ_ЋDЋxЋ Ћ|Бћд=P”НŠPlastics - Determination of tensile properties - Part 1: General principles-First Edition; Corrigendum 1-1994; Amendment 1: 09-01-2005TНŠ†ЋFЋzЋ Ћ|Бћд=PОŠ”ОŠPlastics - Determination of tensile properties - Part 1: General principles-First Edition; Corrigendum 1-1994; Amendment 1: 09-01-2005xЋ Ћ|Бћд=PНŠ”НŠPlastics - Determination of tensile properties - Part 1: General principles-First Edition; Corrigendum 1-1994; Amendment 1: 09-01-2005TНŠ†ЋFЋzЋ Ћ|Бћд=PщЛ_1еЇyKяС“e7 л­Q#ѕЧ™k=сГ…W)ћЭŸqCщ М  b 5 `ўjЉUщ•AЭyБ0мКь˜D№mШtУoƒ/—Cц’ѓŸХ ? ы — + з k  Њ V у  # ЯV‚.ж‚*жgЅQк†ЌXь˜Ф`џN˜йM%Ќ2АATTОŠ†ЋH|Ќ Ќ|Бћд=P”ПŠPlastics - Determination of tensile properties - Part 1: General principles-First Edition; Corrigendum 1-1994; Amendment 1: 09-01-2005TПŠ†ЌЌ~Ќ Ќ|Бћд=PTРŠ/Handbook for Electrical Safety in the Workplace`RѓF0ВхКЉ@` TСŠ/Standard for Electrical Safety In the Workplace`RѓF0ВхКЉ@` aТŠEnvironmental management systems Requirements with guidance for use-Second EditionTТŠSЌЌЌ Ќ|Бћд=PlУŠGeneral requirements for the competence of testing and calibration laboratories-Second editionTУŠ^ЌЌ‘Ќ Ќ|Бхд=PТФŠGraphic Symbols for Electrical and Electronics Diagrams )Including Reference Designation Class Designation Letters)-CSA Z99-75; Includes supplement to ANSI 732.2-75 and IEEE 315-75TФŠДЌ Ќ•Ќ Ќ|Бхд=PlХŠGeneral requirements for the competence of testing and calibration laboratories-Second editionTХŠ^Ќ Ќ›Ќ Ќ|Бiд=PlЦŠGeneral requirements for the competence of testing and calibration laboratories-Second editionTЦŠ^Ќ ЌŸЌ Ќ|Бiд=PwЧŠMedical Devices - Application of Risk Management to Medical Devices-First Edition; Amendment 1: 3/01/2003TЧŠiЌЌЅЌ Ќ|Бхд=P”ШŠNAS Certification & Qualification of Nondestructive Test Personnel-REV 2; Includes corrected Sheet 13 with (*) notation under Table IVTШŠ†ЌЌЊЌ Ќ|Бiд=PYЩŠStructural Welding Code - Steel-Errata 1:2004; Errata 2:2004; Errata 3:2005TЩŠKЌЌЎЌ Ќ|Бћд=PTЪŠ"Tempered or Laminated Safety Glass`sF0ВћКЉ@` ЫŠFunctional Safety of Electrical/Electronic/programmable Electronic Safety - Related Systems Set *** Contains IEC 61508-1 Through IEC 61508-7***TЫŠЌЌИЌ Ќ|Бiд=PqЬŠQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TЬŠcЌЌМЌ Ќ|Бћд=PlЭŠGeneral requirements for the competence of testing and calibration laboratories-Second editionTЭŠ^ЌЌФЌ Ќ|Бiд=PlЮŠGeneral requirements for the competence of testing and calibration laboratories-Second editionTЮŠ^ЌЌЦЌ Ќ|Бiд=PlЯŠGeneral requirements for the competence of testing and calibration laboratories-Second editionTЯŠ^ЌЌЧЌ Ќ|Бiд=PlаŠGeneral requirements for the competence of testing and calibration laboratories-Second editionTаŠ^Ќ ЌЩЌ Ќ|Бiд=PlбŠGeneral requirements for the competence of testing and calibration laboratories-Second editionTбŠ^Ќ"ЌЪЌ Ќ|Бiд=PlвŠGeneral requirements for the competence of testing and calibration laboratories-Second editionTвŠ^Ќ$ЌЬЌ Ќ|Бiд=P~гŠInformation technology Security techniques Code of practice for information security management-Second EditionTгŠpЌ&ЌвЌ ­|Бћд=PlдŠGeneral requirements for the competence of testing and calibration laboratories-Second editionTдŠ^Ќ(ЌжЌ Ќ|Бхд=PaеŠEnvironmental management systems Requirements with guidance for use-Second EditionTеŠSЌ*ЌмЌ Ќ|Бiд=PVжŠQuality Management Systems - Guidelines for Quality Plans-Second EditionTжŠHЌ,ЌрЌ Ќ|Бiд=P{зŠMeasurement Management Systems - Requirements for Measurement Processes and Measuring Equipment-First EditionTзŠmЌ.ЌфЌ Ќ|Бћд=P{иŠMeasurement Management Systems - Requirements for Measurement Processes and Measuring Equipment-First EditionTиŠmЌ0ЌцЌ Ќ|Бћд=P{йŠMeasurement Management Systems - Requirements for Measurement Processes and Measuring Equipment-First EditionTйŠmЌ2ЌчЌ Ќ|Бхд=PTкŠ@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176TлŠ@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176TмŠ@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176TнŠ@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176TоŠ@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176qпŠQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TпŠcЌ9Ќ Ќ Ќ|Бхд=PqрŠQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TрŠcЌ;Ќ Ќ Ќ|Бхд=PqсŠQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TсŠcЌ=Ќ Ќ Ќ|Бхд=P~тŠInformation technology Security techniques Code of practice for information security management-Second EditionTтŠpЌ?Ќ Ќ Ќ|Бaд=PbуŠStandard Classification for Building Floor Area Measurements for Facility ManagementTуŠTЌAЌ Ќ Ќ|Быд=PbфŠStandard Classification for Building Floor Area Measurements for Facility ManagementTфŠTЌCЌ Ќ Ќ|Быд=P…хŠAcceptance sampling procedures by attributes Specified quality levels in nonconforming items per million-First EditionTхŠwЌEЌ Ќ Ќ|Быд=PbцŠHydraulic Fluid Power - Quick-Action Couplings - Part 2: Test Methods-Second EdiuionTцŠTЌGЌ( Ќ Ќ|Быд=PXчŠQuality Management - Guidelines for Training-First Edition; ISO 10015:1999TчŠJЌIЌ- Ќ Ќ|Бaд=PTшŠ:Quality Management - Guidelines for Training-First Editionы`ШЗBщŠlщŠGeneral requirements for the competence of testing and calibration laboratories-Second editionTщŠ^ЌLЌ5 Ќ Ќ|Быд=PXчŠQuality Management - Guidelines for Training-First Edition; ISO 10015:1999TчŠJЌIЌ- Ќ Ќ|Бaд=PTшŠ:Quality Management - Guidelines for Training-First Editionы`ШЗBFHйF,К@^шF ъ˜HйF0ЗжFўџЇЇбeЏWЁMШtО\Š6ХqЌ;ч“?ы—CШtљЅ*ж€,Ыw З9хy%Й e љ Ѕ 9 х y % Й e є    Џ[ЎЦOћ;Я{ЙeљЅD№œHД`џM˜йF.­4œЦNcћŠISO 9000 COLLECTION 1-INCLUDES MOST CURRENT REVISIONS OF ISO 9000, ISO 9001, ISO 9004TћŠU­­` ­ ­|Бѓд=PcќŠISO 9000 COLLECTION 1-INCLUDES MOST CURRENT REVISIONS OF ISO 9000, ISO 9001, ISO 9004TќŠU­­c ­ ­|Бѓд=P§ŠDocument management - Electronic document file format for long-term preservation - Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionT§Š­­h ­ ­|Бкд=PТўŠGraphic technology Prepress digital data exchange using PDF Part 6: Complete exchange of printing data suitable for colour-managed workflows using PDF 1.4 (PDF/X-3)-First EditionTўŠД­­j ­ ­|Бяд=PВџŠGraphic technology Prepress digital data fxchange using PDF Part 4: Complete exchange of CMYK and spot colour printing data using PDF 1.4 (PDF/X-1a)-First EditionTџŠЄ­­l ­ ­|Бяд=Pa‹Environmental management systems Requirements with guidance for use-Second EditionT‹S­ ­r ­ ­|Бѓд=Pl‹Occupational health and safety management systems Specification-AMD 14223: December 13, 2002;T‹^­ ­z ­ ­|Бяд=Pa‹Environmental management systems Requirements with guidance for use-Second EditionT‹S­­‚ ­ ­|Бвд=Pa‹Environmental management systems Requirements with guidance for use-Second EditionT‹S­­„ ­ ­|Бвд=Pa‹Environmental management systems Requirements with guidance for use-Recond EditionT‹S­­† ­ ­|Бвд=PO.‹Earth-Moving Machinery - Operator´s Controls-Second EditionT.‹A­­!­ ­|Б‰д=P/‹Earth-Moving Machinery - Operator´s Seat - Dimensions and Requirements-First Edition; Amendment 1: 03/01/2001T/‹s­­ !­ ­|Б‰д=PT0‹5Earth-Moving Machinery - Access Systems Fifth EditionГ‰‡™Gаˆ“Go1‹Earth-Moving Machinery - Operator´s Field of View - Part 2: Evaluation Method First EditionT1‹a­­ !­ ­|Бяд=Po2‹Earth-Moving Machinery - Operator´s Field of View - Part 2: Evaluation Method First EditionT2‹a­­!­ ­|Бѓд=PT3‹5Earth-Moving Machinery - Access Systems Fifth EditionГ‰†™Gаˆ“GT4‹Product Safety Signs and Labels`2єG0ВкКЉ@` T5‹Product Safety Signs and Labels`2єG0ВкКЉ@` T6‹9Guide To The Use Of The Wind Load Provisions Of ASCE 7-02Љ@` T7‹Safety standard for lift trucks`RњG0В‰КЉ@` m8‹Quality Management Systems - Aerospace - Requirements-Technically Equivalent to AECMA prEN 9100T8‹_­"­.!­ ­|Бвд=P9‹Information technology - Security techniques - Information security management systems - Requirements-First EditionT9‹s­$­2!­ ­|Б+д=Pd:‹Information technologyMetadata registries (MDR) Part 1: Framework-ISO/IEC 11179-1:2004T:‹V­&­6!­ ­|Б+д=P{;‹Information technologyMetadata registries (MDR) Part 2: Classification for dbta elements-ISO/IEC 11179-2:2000T;‹m­(­8!­ ­|Б+д=P‚<‹Information technologyMetadata registries (MDR) Part 3: Registry metamodel and basic attributes-ISO/IEC 11179-3:2003T<‹t­*­:!­ ­|Б+д=Pz=‹Information technologyMetadata registries (MDR) Part 4: Formulation of data definitions-ISO/IEC 11179-4:2004T=‹l­,­‹Information technologyMetadata registries (MDR) Part 6: Registration-ISO/IEC 11179-6:2005T>‹Y­.­>!­ ­|Б+д=P‘?‹Information technologyMetadata registries (MDR) Part 5: Naming and identification principles for data elements-ISO/IEC 11179-5:1995T?‹ƒ­0­@!­ ­|Б+д=Pg@‹Information technologyMetadata registries (MDR) Part 6: Rfgistration-ISO/IEC 11179-6:2005T@‹Y­2­B!­ ­|Б+д=PgA‹Information technologyMetadata registries (MDR) Part 6: Registration-ISO/IEC 11179-6:2005TA‹Y­4­D!­ ­|Б+д=PdB‹Information technologyMetadata registries (MDR) Part 1: Framework-ISO/IEC 11179-1:2004TB‹V­6­F!­ ­|Б+д=PdC‹Information"technologyMetadata registries (MDR) Part 1: Framework-ISO/IEC 11179-1:2004TC‹V­8­H!­ ­|Б+д=PdD‹Information technologyMetadata registries (MDR) Part 1: Framework-ISO/IEC 11179-1:2004TD‹V­:­J!­ ­|Б+д=PlE‹General requirements for the competence of testing and calibration laboratories-Second editionTE‹^­<­P!­ ­|БЗд=PwF‹Medical Devices - Application of Risk Management to Medical Devices-First Edition; Amendment 1: 3/01/2003TF‹i­>­T!­ ­|БЪд=PlG‹General requirements for the competence of testing and calibration laboratories-Second editionTG‹^­@­_!­ ­|БЏд=P€H‹Insert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standarf Assembly Dimensions for-FSC 5340TH‹r­B­c!­ ­|БЏд=PXI‹Low-Pressure Connecting Assemblies for Medical Gas Systems-Second Edition;TI‹J­D­h!­ ­|БЇд=PˆJ‹Guidelines for Quality Management System Documentation-First Edition; ISO/TR 10013: 2001; Replaces CAN/CSA-ISO 10013: 1995TJ‹z­F­m!­ ­|БЪд=PVK‹Quality Management Systems - Fundamentals and Vocabulary-Third EditionTK‹F­H­q!­ ­|БЏд=P”L‹Evaluation De L´Efficacite Des Agents Antimicrobiens Utilises Sur Des Surfaces Environnementales Et Sur Les Instruments MedicauxTL‹†­J­u!­ ­|БЏд=PM‹“M‹Agricultural Wheeled Tractors - Rear-Mounted Three-Point Linkage - Part 1: Categories 2, 2, 3 and 4-Third Edition; Corrigendum 1-1995F­H­q!­ ­|БЏд=PL‹”L‹Evaluation De L´Efficacite Des Agents Antimicrobiens Utilises Sur Des Surfaces Environnementales Et Sur Les Instruments Medicaux(ПьC88 8ПьC˜йPБьCчча4›9ЅQ§Љ!Эu!ЁMсТVžJц’.кsИdгФJіt ЅQэ™Ф W  Џ [  Г _ № œ - й …  Аa ЌXїЃBю‚.ЭyЧsБ]ЮzУ`џI˜йS)Ў5d2ƒ‹Information Technology - Software Life Cycle Processes-First Edition; Amendment 1: 5/01/2002; Amendment 2: 11/01/2004T‹uЎЎŽ Ў Ў|Бяд=Pƒ‹Information Technology - Software Life Cycle Processes-First Edition; Amendment 1: 5/01/2002; Amendment 2: 11/01/2004T‹uЎЎ‘ Ў Ў|Бкд=PР‹Medical Electrical Equipment Part 2: Particular Requirements for the Safety of Associated Equipment of X-Ray Equipment-Also known as BS 5724: Section 2.32:1965; IEC 601-2-32:1994T‹ВЎЎ— Ў Ў|Бяд=PT‹7Quality Management Systems - Requirements-Third EditionКЉ@ˆ Р ‹Medical Electrical Equipment Part 2: Particular Requirements for the Safety of Associated Equipment of X-Ray Equipment-Also"known as BS 5724: Section 2.32:1965; IEC 601-2-32:1994T ‹ВЎЎ Ў Ў|Бѓд=P~ ‹Information technology Security techniques Code of practice for information security management-Second EditionT ‹pЎ ЎЁ Ў Ў|Бяд=P ‹Information technology - Security techniques - Information security management systems - Requirements-First EditionT ‹sЎ ЎЃ Ў Ў|Бкд=Pa ‹Environmental management systems Requirements with guidance for use-Second EditionT ‹SЎ ЎЉ Ў Ў|Бяд=Pa ‹Environmental management systems Requirements with guidance for use-Second EditionT ‹SЎЎ­ Ў Ў|Бяд=PS‹Standard Symbols for Welding, Brazing, and Nondestructive ExaminationT‹EЎЎД Ў Ў|Бяд=Pl‹General requirements for the competence of testing and calibration laboratories-Second editionT‹^ЎЎИ Ў Ў|Б‰д=Pl‹General requirements for the competence of testing and calibration laboratories-Second editionT‹^ЎЎК Ў Ў|Б‰д=Pl‹General requirements for the competence of testjng and calibration laboratories-Second editionT‹^ЎЎО Ў Ў|Б‰д=P‘‹Technical Report: Risk Assessment and Risk Reduction - A Guide to Estimate, Evaluate and Reduce Risks Associated with Machine ToolsT‹ƒЎЎФ Ў Ў|Бяд=P†‹Information technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)T‹xЎЎШ Ў Ў|Б‰д=P†‹Information technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)T‹xЎЎЪ Ў Ў|Бѓд=P†‹Information technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)T‹xЎЎЬ Ў Ў|Бѓд=Py‹Joint Industry Standard Implementation of Ball Grid Array and Other High Density Technology (EIA J-STD-013)T‹kЎ!Ўа Ў Ў|Б‰д=Pl‹General requirements for the competence of testing and calibration laboratories-Second editionT‹^Ў#Ўд Ў Ў|Б‰д=Pl‹General requirements for the competence of testing and calibration laboratories-Second editionT‹^Ў%Ўк Ў Ў|Бкд=Pl‹General requirements for the competence of testing and calibration laboratories-Second editionT‹^Ў'Ўм Ў Ў|Б‰д=PTM‹…­LЎy!Ў Ў|БЗд=P”_‹NAS Certification & Qualification of Nondestructive Test Personnel-REV 2; Includes corrected Sheet 13 with (*) notation under Table IVT_‹†Ў*Ўš!Ў Ў|Б+д=Pl`‹General requirements for the competence of testing and calibration laboratories-Second editionT`‹^Ў,ЎŸ!Ў Ў|БЗд=Pla‹General requirements for the competence of testing and calibration laboratories-Second editionTa‹^Ў.ЎЁ!Ў Ў|Бвд=PЎb‹Standard Test Method for Resistance to Environmentan Degradation of Electrical Pressure Connections Involving Aluminum and Intended for Residential ApplicationsTb‹ Ў0ЎЉ!Ў Ў|БŸд=P‘c‹Technical Report: Risk Assessment and Risk Reduction - A Guide to Estimate, Evaluate and Reduce Risks Associated with Machine ToolsTc‹ƒЎ2ЎЋ!Ў Ў|БŸд=PTd‹;INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-10th EditionOf‹Safety of Machinery - Principles of Risk Assessment-First EditionTe‹AЎ5ЎБ!Ў Ў|БŸд=P†f‹Information technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)Tf‹xЎ7ЎЕ!Ў Ў|БЗд=P†g‹Information technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)Tg‹xЎ9ЎЗ!Ў Ў|БЗд=P†h‹Information technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)Th‹xЎ;ЎЙ!Ў Ў|БЪд=P†i‹Information technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)Ti‹xЎ=ЎЛ!Ў Ў|БЪд=Plj‹General requirements for the competence of testing and calibration laboratories-Second editionTj‹^Ў?ЎО!Ў Ў|БŸд=P~k‹Information technology Security techniques Code of practice for information security management-Second EditionTk‹pЎAЎТ!Ў Ў|Бвд=P‘l‹Rubber, vulcanized or thermoplastic Determination of tear strength Part 1: Trouser, angle"and crescent test pieces-Second EditionTl‹ƒЎCЎШ!Ў Ў|Б+д=PЅm‹Paints and Varnishes - Corrosion Protection of Steel Structures by Protective Paint Systems - Part 6: Laboratory Performance Test Methods-First EditionTm‹—ЎEЎЪ!Ў Ў|БЇд=Pn‹Sn‹Paints and Varnishes - Bend Test (Cylindrical Mandrel)-Second EditionTn‹EЎGЎЬ!Ў Ў|БЇд=P Ў|Б+д=Pm‹Ѕm‹Paints and Varnishes - Corrosion Protection of Steel Structures by Protective Paint Systems - Part 6: Laboratory Performance Test Methods-First EditionTm‹—ЎEЎЪ!Ў Ў|БЇд=P@@Эў-cЊѓ?HZ™lHЁе‚ {'–BФpА*жPќv"œHљЅQРlОjўЊ>ъVЎBю‚.Тnѕ Ё  Ч A э g  ‚ . Т n  ЎBю›Gц’1н\Š6v"ЮК7у`џF˜йS/Џ6xЦ8 q‹Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T‹cЏЏф Џ Џ|Б‰д=PT‹7Quality Management Systems - Requirements-Third EditionКЉ@  q‹Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T‹cЏЏю Џ Џ|Бкд=PЄo‹Paints and Varnishes - Rapid-Deformation (Impact Resistance) Tests - Part 2: Falling-Weight Test, Small-Area Indenter-First Edition; Replaces ISO 6272To‹–ЏЏЮ!Џ Џ|БЇд=Pхp‹Paints and Varnishes - Evaluation of Degradation of Coatings - Designation of Quantity and Size of Defects, and of Intensity of Uniform Changes in Appearance - Part 4: Assessment of Degref of Cracking-Second EditionTp‹зЏЏа!Џ Џ|БЇд=P†q‹Paints and Varnishes - Determination of Resistance to Cathodic Disbonding of Coatings Exposed to Sea Water-First EditionTq‹xЏ Џв!Џ Џ|БЇд=PЩr‹ASD Manual V.#1: Manual of Steel Construction Allowable Stress Design V.#2: Manual of Steel Construction Connections-See AISC M016 for Volume 1 and AISC M017 for Volume"2; Bib Record onlyTr‹ЛЏ Џн!Џ Џ|БŸд=PЩs‹ASD Manual V.#1: Manual of Steel Construction Allowable Stress Design V.#2: Manual of Steel Construction Connections-See AISC M016 for Volume 1 and AISC M017 for Volume 2; Bib Record onlyTs‹ЛЏ Џп!Џ Џ|БŸд=PЩt‹ASD Manual V.#1: Manual of Steel Construction Allowable Stress Design V.#2: Manual of Steel Construction Connebtions-See AISC M016 for Volume 1 and AISC M017 for Volume 2; Bib Record onlyTt‹ЛЏЏс!Џ Џ|БŸд=Plu‹General requirements for the competence of testing and calibration laboratories-Second editionTu‹^ЏЏч!Џ Џ|Бвд=Pqv‹Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994Tv‹cЏЏы!Џ Џ|БЏд=Pqw‹Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994Tw‹cЏЏя!Џ Џ|Бвд=Plx‹General requirements for the competence of testing and calibration laboratories-Second editionTx‹^ЏЏё!Џ Џ|БŸд=Ply‹General requirements for the competence of testing and calibration laboratories-Second editionTy‹^ЏЏѓ!Џ Џ|БŸд=Plz‹General requirements for the competence of testing and calibration laboratories-Second editionTz‹^ЏЏѕ!Џ Џ|БŸд=PT{‹=Stress Corrosion Cracking (SCC) Direct Assessment Methodology q|‹Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T|‹cЏЏ§!Џ Џ|Б+д=Pq}‹Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T}‹cЏ Џџ!Џ Џ|Б+д=PT~‹=Stress Corrosion Cracking (SCC) Direct Assessment Methodology q‹Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T‹cЏ#Џ"Џ Џ|БЇд=Pq€‹Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T€‹cЏ%Џ "Џ Џ|БЇд=P]‹Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000T‹OЏ'Џ"Џ Џ|Бвд=PV‚‹Technical Drawings - Dimensioning and Tolerancing - Cones-Second EditionT‚‹HЏ)Џ"Џ Џ|Бвд=Pqƒ‹Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994Tƒ‹cЏ+Џ"Џ Џ|БЇд=Pq„‹Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T„‹cЏ-Џ"Џ Џ|БЇд=PT–‹1Dimensional Tolerances for Aluminum Mill Products,Г⇙GашЯHВ—‹Banking - Key Management (Retail) - Part 3: Key Life Cycle for Symmetric Ciphers First Edition (CEN EN ISO 11568-3: 1996)-Cancelled and replaced by ISO 11568-2:2005T—‹ЄЏ0Џ?"Џ Џ|БЗд=P˜‹Banking - Key Management (Retail) - Part 3: Key Life Cycle for Symmetric Ciphers First Edition (CEN EN ISO 11568-3: 1996)-Cancelled and replaced by ISO 11568-2:2005T˜‹ЄЏ2ЎC"Џ Џ|БЗд=P™‹Cleanrooms and associated controlled environments Biocontamination control Part 1: General principles and methods-First EditionT™‹Џ4ЏG"Џ Џ|БЗд=PЫš‹Cleanrooms and associated controlled environments Biocontamination control Part 2: Evaluation and interpretation of biocontamination data-First Edition; TECHNICAL CORRIGENDUM 1: 11/1/2004Tš‹НЏ6ЏI"Џ Џ|БЗд=PЫ›‹Cleanrooms and associated controlled environments Biocontamination control Part 2: Evaluation and interpretation of biocontamination data-First Edition; TECHNICAL CORRIGENDUM 1: 11/1/2004T›‹НЏ8ЏM"Џ Џ|БЇд=PЫœ‹Cleanrooms and associated controlled environments Biocontamination control Part 2: Evaluation and interpretation of biocontamination data-First Edition; TECHNICAL BORRIGENDUM 1: 11/1/2004Tœ‹НЏ:ЏQ"Џ Џ|БЇд=PS‹Elevating Work Platforms - Mast-Climbing Work Platforms-First EditionT‹EЏ<ЏU"Џ Џ|Б+д=PSž‹Elevating Work Platforms - Mast-Climbing Work Platforms-First EditionTž‹EЏ>ЏW"Џ Џ|БŸд=PSŸ‹Elevating Work Platforms - Mast-Climbing Work Platforms-First EditionTŸ‹EЏ@ЏY"Џ Џ|БŸд=PВ ‹Banking - Key Management (Retail) - Part 3: Key Life Cycle for Symmetric Ciphers First Edition (CEN EN ISO 11568-3: 1996)-Cancelled and replaced by ISO 11568-2:2005T ‹ЄЏBЏ]"Џ Џ|БЇд=PЁ‹gЁ‹Insert, Screw Thread, Coarse and Fine, Screw Locking, Helical Coil, Cres-Rev. 1; FSC 5325TЁ‹YЏDЏa"Џ Џ|Б+д=Pagement (Retail) - Part 3: Key Life Cycle for Symmetric Ciphers First Edition (CEN EN ISO 11568-3: 1996)-Cancelled and replaced by ISO 11568-2:2005T ‹ЄЏBЏ]"Џ Џ|БЇд=PFGшFG(FG@FGFG @ЧGDЧGHЧGјKЧGLЧGLЧGLЧGXLЧGPPЧG8TЧG0XЧG `VGdVGhVGјkVGлt` ЙeОkLј-йК+з%бЫwВAэ—Cц’!Э\ДCя ~ * ж j  Њ V ъ – % б `  Lƒ/fIѕo6т>ъy%б` Z,іАЮю ^z8О`џE˜йF>БW"5Tyя™}FDБ Б|Бд=PЇzяMedical electrical equipment Characteristics of digital X-ray imaging devices Part 1: Determination of the detective quantum efficiency-First EditionTzя™ББGБ Б|Бд=Pм{яQuality management systems Particular requirements for the application of ISO 9001:2000 for automotive production and relevant service part organizations-Second Edition; Corrected and Reprinted: 12/15/2003T{яЮББJБ Б|Б^д=Pм|яQuality management systems Particular requirements for the application of ISO 9001:2000 for automotive production and relevant service part organizations-Second Edition; Corrected and Reprinted: 12/15/2003T|яЮББMБ Б|Б^д=PЇ}яMedical electrical equipment Characteristics of digital X-ray imaging devices Part 1: Determination of the detective quantum efficiency-First EditionT}я™ББRБ Б|Бд=PЇ~яMedical electrical equipment Characteristics of digital X-ray imaging devices Part 1: Determination of the detective quantum efficiency-First EditionT~я™Б БTБ Б|Б^д=PЇяMedical electrical equipment Characteristics of digital X-ray imaging devices Part 1: Determination of the detective quantum efficiency-First EditionTя™Б БVБ Б|Б^д=PЇ€яMedical electrical equipment Characteristics of digital X-ray imaging devices Part 1: Determination of the detective quantum efficiency-First EditionT€я™Б БXБ Б|Б^д=PЇяMedical electrical equipment Characteristics of digital X-ray imaging devices Part 1: Determination of the detective quantum efficiency-First EditionTя™ББ[Б Б|Б^д=PЇ‚яMedical electrical equipment Characteristics of digital X-ray imaging devices Part 1: Determination of the detective quantum efficiency-First EditionT‚я™ББ]Б Б|Б^д=PЇƒяNedical electrical equipment Characteristics of digital X-ray imaging devices Part 1: Determination of the detective quantum efficiency-First EditionTƒя™ББ`Б Б|Бд=Pg•яGuide ISO 9000 Lignes Directrices Pour L´Application Des Normes ISO 9000-3e EditionT•яYББuБ Б|Б^д=Pq–яStandard Test Methods for Rockwell Hardness and Rockwell Superficial Hardnfss of Metallic MaterialsT–яcББxБ Б|Б^д=P…—яStandard Specification for Carbon and Low-Alloy Steel Forgings, Requiring Notch Toughness Testing for Piping ComponentsT—яwББzБ Б|Б^д=PX˜яFace Protectors and Visors for Ice Hockey Players-General Instruction No 1T˜яJБББ Б|Б^д=P™™яBLEANROOMS AND ASSOCIATED CONTROLLED ENVIRONMENTS SET-INCLUDES: ISO 14644-1, ISO 14644-2, ISO DIS 14644-3, ISO 14644-4, AND ISO DIS 14644-5T™я‹ББ‹Б Б|Бд=PЌšя8 mm Through 200 mm Embossed Carrier Taping and 8 mm & 12 mm Punched Carrier Taping of Surface Mount Components for Automatic Handling-(Revision of EIA-481-B)TšяžББŽБ Б|Бд=PЌ›я8 mm Through 200 mm"Embossed Carrier Taping and 8 mm & 12 mm Punched Carrier Taping of Surface Mount Components for Automatic Handling-(Revision of EIA-481-B)T›яžБ!ББ Б|Бд=PqœяIdentification cards Integrated circuit cards Part 9: Commands for card management-Second EditionTœяcБ#Б–Б Б|Бд=PYяNational Fire Alarm Code-Errata 02-1: 1/30/2003; Errata 72-02-2: 04/16/2003TяKБ%БšБ Б|Бд=P2žяISO STANDARDS COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISO 14001, 14004, 14010, 14011, 14012, DIS 14015, 14020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041, 14042, 14043, TR 14049, 14050, AND TR 14061; SEE ALSO ISO 14000 SERIES AND CDTžя$Б'Б Б Б|Бд=P]ŸяQuality Assurance Program -"Category 3-Second Edition; General Instruction No 1TŸяOБ)БЄБ Б|Б^д=P] яQuality Assurance Program - Category 3-Second Edition; General Instruction No 1T яOБ+БІБ Б|Б^д=P]ЁяQuality Assurance Program - Category 3-Second Edition; General Instruction No 1TЁяOБ-Б­Б Б|Бд=PfЂяHighway Vanks and Portable Tanks for the Transportation of Dangerous Goods-Third EditionTЂяXБ/БГБ Б|Бд=PoЃяTextile Test Methods Combustion Resistance of Mattresses - Cigarette Test-Amendment 1: April 2002TЃяaБ1БЗБ Б|Бд=PoЄяTextile Test Methods Combustion Resistance of Mattresses - Cigarette Test-Amendment 1: April 2002TЄяaБ3БЛБ Б|Б^д=PoЅяTextile Test Methods Combustion Resistance of Mattresses - Cigarette Test-Amendment 1: April 2002TЅяaБ5БНБ Б|Б^д=PoІяTextile Test Methods Combustion Resistance of Mattresses - Cigarette Test-Amendment 1: April 2002TІяaБ7БПБ Б|Бд=PoЇяTextile Test Methods Combustion Resistance of Mattresses - Cigaretve Test-Amendment 1: April 2002TЇяaБ9БФБ Б|Бд=PoЈяTextile Test Methods Combustion Resistance of Mattresses - Cigarette Test-Amendment 1: April 2002TЈяaБ;БШБ Б|Б^д=PaЛяEnvironmental management systems Requirements with guidance for use-Second EditionTЛяSБ=БцБ Б|БVд=PŽМяSmall craft - Hull Construction and Scantlings - Part 3: Materials: Steel, Aluminium Alloys, Wood, Other Materials-First EditionTМя€Б?БэБ Б|Бiд=P^ояShipbuilding - Inland Navigation - Raft-Type Life-Saving Apparatus First EditionTояPБAБbБ Б|БŽд=Pпя^пяShipbuilding - Inland Navigation - Raft-Type Life-Saving Apparatus First EditionTпяPБCБdБ Б|БŽд=P€Б?БэБ Б|Бiд=Pоя^ояShipbuilding - Inland Navigation - Raft-Type Life-Saving Apparatus First EditionTояPБAБbБ Б|БŽд=Pr.PROTOTYPE & TEST LABORATORYE2005/ъŒ*Ьxъ–5сrЏ[ь˜)еfЃOщ•8ф‡3ж‚PќЃOоŠоŠоŠё  E ё l  Ї S ь ˜ ё  іЂћЇЌБ ЖЛп‹Џ[Д`A 2™1ВЩC&ёxml&bigint&­binary&hbit&Џchar&=datetime&jdecimal&>float&"image&8int&<money&яnchar&cntext&lnumeric&чnvarchar&;real&:'smalldatetime&4smallint&z!smallmoney&b#sql_variant&sysname&#text&Нtimestamp&0tinyint&$-uniqueidentifier&Ѕvarbinary&Їvarcharƒ`ƒPƒ Xƒsubid8ƒˆƒxƒџџџџgrantee`ƒАƒ ƒgrantorˆƒш‚Шƒџџџџtypeџџџџмƒмƒшƒшƒ х+0ƒЈ_H‚_Ф‚_Шc$X„00џџџџџџџџџџџџџџџџш„и„ class88 џџџџџџџџџџџџџџџџp…h…id88 џџџџџџџџџџџџџџџџ†№… subid88 џџџџџџџџџџџџџџџџ†€†grantee88 џџџџџџџџџџџџџџџџ ‡‡grantorЏЏџџџџџџџџџџџџџџџџЈ‡ ‡typeЏЏџџџџџџџџџџџџџџџџ(ˆ state ˆх+Ах+ х+]ЉШ&ˆaМ „ФШ&ˆaМ „Фј~ ц Ќџџџџа4‰РQ*‹ R* ц ƒˆ‰Ш&ˆaМ „ФШ&ˆaМ „Фј~јц џџџџа4ŠРQ* R*Мјц Ш&ˆaМ „ФШ&ˆaМ „Фј~ ачџџџџа4‹РQ*ш R*№Ÿач№Ÿ№ŸШ&ˆaМ „ФШ&ˆaМ „Фј~ шH‹џџџџа4ј‹8œРQ* R*X шШ&ˆaМ „ФШ&ˆaМ „Фј~xщ џџџџа4№ŒРQ* R*xщ ˜Ш&ˆaМ „ФШ&ˆaМ „Фј~hъ џџџџа4шРQ* R*ј‡hъ Ш&ˆaМ „ФШ&ˆaМ „ФШ  „џџџџp0$а0$ј~hы џџџџа4РQ* R*hы Ш&ˆaМ „ФШ&ˆaМ „ФШ  „џџџџp0$а0$ј~hьџџџџа4(0РQ* R*hьШ&ˆaМ „ФШ&ˆaМ „ФШ  „џџџџp0$а0$ј~hэџџџџа4H‘РQ* R*hэШ&ˆaМ „ФШ&ˆaМ „Фј~hюџџџџа4@’РQ* R*hюШ&ˆaМ „ФШ&ˆaМ „ФШ  „џџџџp0$а0$ј~hяџџџџа4`“РQ* R*hяШ&ˆaМ „ФШ&ˆaМ „Фј~Ј№џџџџа4X”РQ* R*Ј№Ш&ˆaМ „ФШ&ˆaМ „ФШ  „џџџџp0$а0$ј~Јёџџџџа4x•РQ* R*ЈёШ&ˆaМ „ФШ&ˆaМ „Фј~Ађџџџџа4p–РQ* R*АђШ&ˆaМ „ФШ&ˆaМ „Фј~Рѓџџџџа4h—РQ* R*РѓШ&ˆaМ „ФШ&ˆaМ „Фј~аєџџџџа4`˜HšРQ* R*аєШ&ˆaМ „ФШ&ˆaМ „Фј~шѕџџџџа4X™РQ* R*шѕШ&ˆaМ „ФШ&ˆaМ „Фј~їџџџџа4PšРQ* R*їШ&ˆaМ „ФШ&ˆaМ „Фј~јџџџџа4H›РQ* R*јШ&ˆaМ „ФШ&ˆaМ „Фј~љџџџџа4@œРQ* R*љШ&ˆaМ „ФШ&ˆaМ „Фј~`њџџџџа48РQ* R*`њШ&ˆaМ „ФШ&ˆaМ „Фј~ˆћџџџџа40žРQ* R*ˆћШ&ˆaМ „ФШ&ˆaМ „ФШ  „џџџџp0$а0$ј~˜ќџџџџа4PŸРQ* R*˜ќШ&ˆaМ „ФШ&ˆaМ „`їЪЏ{`=џиУІ‹t]F3ъЭИЅŒs Z2іГЩ™0^y8О`ac ЙДЯƒ Т@0WSр'preserve0WSр'collapse0WSр'collapse0WSр'collapse0WSр'collapse0WSр'collapse0WSр'collapse0WSр'collapse0WSр'collapse0WSр'collapse0WSр'collapse0WSр'collapse0WSр'collapse0WSр'collapse0WSр'collapse0WSр'collapse0WSр'collapse0 WSр'collapse0!WSр'collapse0dWSр%replace0eWSр'collapse0fPTрY[a-zA-Z]{1,8}(-[a-zA-Z0-9]{1,8})*[a-zA-Z]{1,8})(-[a-zA-Z]{1,8})*0gPTр!\i\c*0hPTр9[\i-[:]][\c-[:]]*0lPTр\c+0mDFр00nIXр00oIXр-10pINр?-92233720368547758080pIXр=92233720368547758070qINр--21474836480qIXр+21474836470rINр#-327680rIXр!327670sINр-1280sIXр1270tINр00uIXр?184467440737095516150vIXр+42949672950wIXр!655350xIXр2550yINр10ШLNр10ЩLNр10ЪLNр10EUр%default0EUр'preserve0,EUр#BigInt0,EUр#Binary0,EUрBit0,EUрChar0,EUр'DateTime0,EUр%Decimal0,EUр!Float0,EUр!Image0, EUрInt0, EUр!Money0, EUр!NChar0, EUр!NText0, EUр'NVarChar0,EUрReal0,EUр1SmallDateTime0,EUр'SmallInt0,EUр+SmallMoney0,EUр%Variantiant0,EUрText0,EUр)Timestamp0,EUр%TinyInt0,EUрUdt0,EUр7UniqueIdentifier0,EUр-UtcDateTime0,EUр)VarBinary0,EUр%VarChar0,EUрXml0-EUр%Default0-EUрNone0-EUр+IgnoreCase2-EUр3IgnoreNonSpace0-EUр3IgnoreKanaType0-EUр-IgnoreWidth0-EUр+BinarySort0-EUр-BinarySort208LXр80DPTрg((000[1-9])|(00[1-9][0-9])|(0[1-9][0-9]{2})|([1-9][0-9]{3}))-((0[1-9])|(1[012]))-((0[1-9])|([12][0-9])|(3[01]))T(([01][0-9])|(2[0-3]))(:[0-5][0-9]){2}(\.[0-9]{2}[037])?0DIXрE9999-12-31T23:59:59.9970DINрE1753-01-01T00:00:00.0000EPTрG((000[1-9])|(00[1-9][0-9])|(0[1-9][0-9]{2})|([1-9][0-9]{3}))-((0[1-9])|(1[012]))-((0[1-9])|([12][0-9])|(3[01]))T(([01][0-9^)|(2[0-3]))(:[0-5][0-9])(:00)0EIXр=2079-06-06T23:59:000EINр=1900-01-01T00:00:000FDTр190FDFр40FIXр?922337203685477.58070FINрA-922337203685477.58080GDTр100GDFр40GIXр-214748.36470GINр/-214748.36480HPTрU([0-9a-fA-F]{8}-[0-9a-fA-F]{4}-[0-9a-fA-F]{4}-[0-9a-fA-F]{4}-[0-9a-fA-F]{12})|(\{[0-9a-fA-F]{8}-[0-9a-fA-F]{4}-[0-9a-fA-F]{4}-[0-9a-fA-F]{4}-[0-9a-fA-F]{12}\})0,EUр)VarBinary0,EUр%VarChar0,EUрXml/ / / / /  § о Ы И ™ † k L 1  ї ф U @  є Х   љљЪ„i(щаЕx;єЏj ъ Н ’ e 2 џ д Е  œwNС Є  V 7 п И ‡ h A џоС Z3їдБŠeL3фУ˜Y@#уР•h+ьбИŸ‚I(‘jEїаЉ‚[4 цП˜qJ#ќеЎ‡` ZгіЕytT^8 ŒО` ZйіЖy%^8 @@с6пqД—О`  њ *ЮЗ1ќ—# 0 ќihs.com0 ќtest.com0 ќgmail.com0  ќscc.ca_rШО 0anabledal_@Ч 0+xv @р`8 0-"jhШО Шa@SЌАŒЧ  YВch ƒ @рas88 @a8XАТ3ћй^№Œ @р88 hрz @рhh] џџџџёa"ф ptT44ЌА€ѕ џџџџЄЦ €ѕ `z`z( LuАР  Ц ЄЦ nvhx  uyd<6јu v(v  (`хpyeSpecs 6ˆСф €ѕ 0>ф sys sysidxst usмђ"˜М ј˜:˜ѕ ЄЦ ˜М рЛ  џџџџv№˜М  Аv(`х( Hxxx(`хФvАР ЄЦ 8v(`хшvАР ЄЦ ( (`х wАР ЄЦ (`х0wАР ЄЦ њвB(`хTwАР ЄЦ 0wЈф @Ѕ Јa`aЄЦ Haa0a”Р @@h@(`хhxАР ":Ѓ/x(`х,xАР  xЄЦ  xШx0x6xx@xеŸ”_иF 6PxXxђжо`x6Hxpx~б}1 6ˆТ€xўйxЌА xџџџџЈxАx€/4иО4ЈzРxЌА€ѕ аxиx€ѕ рx@y№xRАџ^yyXy y@0Љ€žа0yz@yPyd`ypyАy№y€y&y(`хŸј‹G ysqlsysАymresouРye 6ˆТаyўйрysšsysp№yvaluesz€ѕ џџџџzџџџџpЎ6 zˆн"˜ѕ 0zˆЭ `І @z&іџџџџˆzPz№`zˆЭ pzЈz€z(`хz z(`хМzАР АzЄЦ ИzРzј}(`хрzаzЄЦ ˆНрz(`х№zАР ЄЦ {№|˜}{({АР  { }0{(`хL{АР @{ЄЦ џџџџP{А}(`хp{a{ЄЦ иЫ @„аё{рŠа@i˜qиЫ @@k„м И‹аpkиЫ @иЫ @ kq{p‹аџџџ§|PА €}€}(`х$|АР ЄЦ er8}(~H|АР ЄЦ sШ}Ш}(`хl|АР ЄЦ 8_ P}P}(`х|@|ЄЦ  }р}(`хД|АР ЄЦ ~~(`хи|АР |№wТ3˜}ш|њвBИxТ3р}}~б}1ˆyТ3X~}бeр|Т3(~0}{Жz {Т3H}}ќgє№{Т3А}`}хn"Ш|Т30}x}К|ž }Т3№|}Г„Ьx~Т3h}Ј}…†хЪ`Т3€}ЙєАh  Т3}и}~СнS8Ё Т3№}Б ХЂЂ Т3~п?Vа}Т38} ~‹F:PИЃ Т38~кы?˜Є Т3 }P~4јБŠ„˜ѕ ~Аѕ r8z8i <6p~ш~џџ(`хtџџ˜Ÿ6t6<6 Р~(`хiџџџџi <6hpttрz @р00a@†Эўџџя_№?ˆУ@Д—{`џF˜йiИ>дЩ@E,TєЊ—GR'И И|Быд=PŠѕЊOptics and Optical Instruments - Environmental Test Methods - Part 17: Combined Contamination, Solar Radiation First EditionTѕЊ|ИИU'И И|Быд=PіЊOptics and Optical Instruments - Environmental Test Methods - Part 18: Combined Damp Heat and Low Internal Pressure First EditionTіЊИИW'И И|Быд=PЂїЊOptics and Optical Instruments - Environmental Test Methods - Part 19: Temperature Cycles Combined with Sinusoidal or Random Vibration First EditionTїЊ”ИИY'И И|Быд=PЁјЊOptics and Optical Instruments - Environmental Test Methods - Part 20: Humid Atmosphere Containing Sulfur Dioxide or Hydrogen Sulfide-Eirst EditionTјЊ“ИИ['И И|Быд=PœљЊOptics and Optical Instruments - Environmental Test Methods - Part 21: Combined Low Pressure and Ambient Temperature or Dry Heat-First EditionTљЊŽИ И]'И И|Бд=PœњЊOptics and Optical Instruments - Environmental Test Methods - Part 21: Combined Low Pressure and Ambient Temperature or Dry Heat-First EditionTњЊŽИ И_'И И|Б†д=PiћЊFood safety management systems Guidance on the application of ISO 22000:2005-First EditionTћЊ[И Иg'И И|Блд=PlќЊGeneral requirements for the competence of testing and calibration laboratories-Second editionTќЊ^ИИn'И И|Блд=Pм§ЊStandard Welding Procedure Specification (SWPS) for Qhielded Metal Arc Welding of Galvanized Steel(M-1), 10 Through 18 Gauge, in the As-Welded Condition, with or without Backing Site License-Errata: 01/2005T§ЊЮИИr'И И|Буд=PмўЊStandard Welding Procedure Specification (SWPS) for Shielded Metal Arc Welding of Galvanized Steel(M-1), 10 Through 18 Gauge, in the As-Welded Condition, with or without Backing Site License-Errata: 01/2005TўЊЮИИt'И И|Буд=PмџЊStandard Welding Procedure Specification (SWPS) for Shielded Metal Arc Welding of Galvanized Steel(M-1), 10 Through 18 Gauge, in the As-Welded Condition, with or without Backing Site License-Errata: 01/2005TџЊЮИИu'И И|Буд=PlЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTЋ^ИИ{'И И|Быд=PlЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTЋ^ИИ'И И|БЛд=PlЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTЋ^ИИ‡'И И|Бд=PaЋEnvironmental management systems Requirements with guidance for use-Second EditionTЋSИИŒ'И И|Б†д=PlЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTЋ^ИИ'И И|БЛд=PlЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTЋ^И!И’'И И|БЛд=PlЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTЋ^И#И“'И И|Бд=PlЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTЋ^И%И•'И И|Бд=PlЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTЋ^И'И—'И И|Бд=Pl ЋGeneral requirements for the competence of testing and calibration laboratories-Second editionT Ћ^И)И™'И И|Бд=P] ЋSpecification for Carbon Steel Electrodes and Rods for Gas Shielded Arc WeldingT ЋOИ+Иœ'И И|Буд=Pl ЋGeneral requirements for the competence of testing and calibration laboratories-Second editionT Ћ^И-И 'И И|Б†д=Pl ЋGeneral requirements for the competence of testing and calibration laboratories-Second editionT Ћ^И/ИЃ'И И|Б†д=Pч Ћ16 mm, 24 mm, 32 mm, 44 mm & 56 mm Embossed Carrier Taping of Surface Mount Components for Automatic Handling-Revision of 481-2 and Inclusion of EIA-481-3; Revision of EIA-481-2-A and Inclusion of Parts of EIA-481-1-AT ЋйИ1ИІ'И И|Бд=P]ЋSpecification for Carbon Steel Electrodes and Rods for Gas Shielded Arc WeldingTЋOИ3ИЊ'И И|БЛд=P˜ЋGeneral requirements for the competence of testing and calibration laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TЋŠИ5ИЎ'И И|БЛд=PlЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTЋ^И7ИА'И И|БЛд=PTЋ-Distribution Systems Operation and Management€оIРЮџHpокD4ВлКЉ@˜ЋEarth-Moving Machinery - Braking Systems of Rubber-Tyred Machines - Systems and Performance Requirements and Test Procedures-Third EditionTЋŠИ:ИЛ'И И|Быд=P ЋSound system equipment: Headphones and!earphones associated with portable audio equipment Maximum sound pressure level measurement methodology and limit considerations Part 2: Matching of sets with headphones if either or both are offered separatelyTЋћИ<ИП'И И|Бд=PTЋ$Welded Steel Tanks for Water Storage`ВТI0ВуКЉ@` TЋ'Acceptability for Electronic AssembliesЉ@P@ITЋ'Acceptability for Electronia AssembliesЉ@P@ITЋ>Requirements for Soldered Electrical and Electronic AssembliesITЋ>Requirements for Soldered Electrical and Electronic AssembliesIIЌЋ8 mm Through 200 mm Embossed Carrier Taping and 8 mm & 12 mm Punched Carrier Taping of Surface Mount Components for Automatic Handling-(Revision of EIA-481-B)TЋžИCИб'И И|Блд=PЋЋStandard Specification eor Commercial Steel (CS) Sheet, Carbon, (0.15 Maximum Percent) Cold-Rolled-Replaced by ASTM A 1008/A1008MiesIIЋЌЋ8 mm Through 200 mm Embossed Carrier Taping and 8 mm & 12 mm Punched Carrier Taping of Surface Mount Components for Automatic Handling-(Revision of EIA-481-B)кxЬx$а|(дЫwп‹7Ыwп‹.кѓŸ3пsТnЎBю‚.ТnЎBю  9 Э y Й M љ  Щ э™Нi§Љ@ьPќ` ku!’>Д`џN˜й€ђЙ?СpTЋИEж'Й Й|БЛд=PЋProject 25 Digital Radio Over-The-Air Reketing (OTAR) Protocol Addendum 2 - Data Link Independent OTAR-Addendum 2TЋqЙЙл'Й Й|Быд=PlЋNon-Destructive Testing - Magnetic Particle Testing - Part 1: General Principles-First EditionTЋ^ЙЙс'Й Й|Б†д=P~ЋInformation technology Security techniques Code of practice for information security management-Second EditionTЋpЙЙч'Й Й|Бд=PrЋMachinery for Forestry - Forwarders - Terms, Definitions and Commercial Specifications-First EditionTЋdЙЙы'Й Й|БЛд=P”ЋSelf Propelled Macjinery for Forestry - Roll-Over Protective Structures - Laboratory Tests and Performance Requirements-Second EditionTЋ†Й Йэ'Й Й|Б†д=Pv ЋConformity Assessment - General Requirements for Bodies Operating Certification of Persons-First EditionT ЋhЙ Йє'Й Й|Б†д=PT2Ћ@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176Z3ЋPiston-Operaved Volumetric Apparatus - Part 2: Piston Pipettes-First EditionT3ЋLЙЙ(Й Й|Быд=P‰4ЋPiston-Operated Volumetric Apparatus - Part 6: Gravimetric Methods for the Determination of Measurement Error-First EditionT4Ћ{ЙЙ(Й Й|Быд=PX5ЋMicrometers-Supersedes 39-GP-18a, August 1957 and 39-GP-18M, February 1979T5ЋJЙЙ1(Й Й|Бд=PX6ЋMicrometers-Supersedes 39-GP-18a, August 1957 and 39-GP-18M, February 1979T6ЋJЙЙ3(Й Й|Бд=PT7Ћ-Vernier, Dial and Digital Calipers and Gauges IР.МI žаI4ВЛКЉ@T8Ћ-Vernier, Dial and Digital Calipers and Gauges[IјWїH0ВлКЉ@РT9Ћ-Vernier, Dial and Digital Calipers and Gauges[IјWїH0ВлКЉ@Р`:ЋStandard Practice for Preparing, Cleaning, anf Evaluating Corrosion Test SpecimensT:ЋRЙЙJ(Й Й|Блд=P`;ЋStandard Practice for Preparing, Cleaning, and Evaluating Corrosion Test SpecimensT;ЋRЙЙN(Й Й|Блд=P”<ЋMicrobiology of Food and Animal Feeding Stuffs - General Rules for Microbiological Examinations-Second Edition; Amendment 1:04-01-2001T<Ћ†ЙЙR(Й Й|Бд=P”=ЋMicrobiology of Food and Animal Feeding Stuffs - General Rules for Microbiological Examinations-Second Edition; Amendment 1:04-01-2001T=Ћ†ЙЙT(Й Й|Бд=PŽ>ЋMethods for Microbiological Examination of Food and Animal Feeding Stuffs - Part 0: General Laboratory Practices-ISO 7218: 1996;T>Ћ€Й!ЙV(Й Й|Бд=PŽ?ЋMethods for Microbinlogical Examination of Food and Animal Feeding Stuffs - Part 0: General Laboratory Practices-ISO 7218: 1996;T?Ћ€Й#ЙX(Й Й|Бд=PŽ@ЋMethods for Microbiological Examination of Food and Animal Feeding Stuffs - Part 0: General Laboratory Practices-ISO 7218: 1996;T@Ћ€Й%ЙZ(Й Й|Бд=P`AЋStandard Practice for Preparing, Cleaning, and Evaluating Corrosion Test SpecimfnsTAЋRЙ'Й^(Й Й|Бд=P”BЋMicrobiology of Food and Animal Feeding Stuffs - General Rules for Microbiological Examinations-Second Edition; Amendment 1:04-01-2001TBЋ†Й)Й_(Й Й|Бд=P”CЋMicrobiology of Food and Animal Feeding Stuffs - General Rules for Microbiological Examinations-Second Edition; Amendment 1:04-01-2001TCЋ†Й+Йa(Й Й|Бд=P”DЋMicrobiology of Food and Animal Feeding Stuffs - General Rules for Microbiological Examinations-Second Edition; Amendment 1:04-01-2001TDЋ†Й-Йe(Й Й|Буд=P”EЋMicrobiology of Food and Animal Feeding Stuffs - General Rules for Microbiological Examinations-Second Edition; Amendment 1:04-01-2001TEЋ†Й/Йg(Й Й|Буд=PXFЋMicrometers-Supersedes 39-GP-18a, August 1957 and 39-GP-18M, February 1979TFЋJЙ1Йk(Й Й|Бд=PXGЋMicrometers-Supersedes 39-GP-18a, August 1957 and 39-GP-18M, February 1979TGЋJЙ3Йm(Й Й|Бд=PXHЋMicrometers-Supersedes 39-GP-18a, August 1957 and 39-GP-18M, February 1979THЋJЙ5Йo(Й Й|Бд=PXIЋMicrometers-Supersedes 39-GP-18a, August 1957 and 39-GP-18M, February 1979TIЋJЙ7Йp(Й Й|Бд=PXJЋMicrometers-Supersedes 39-GP-18a, August 1957 and 39-GP-18M, February 1979TJЋJЙ9Йr(Й Й|Бд=PXKЋMicrometers-Supersedes 39-GP-18a, August 1957 and 39-GP-18M, February 1979TKЋJЙ;Йs(Й Й|Быд=PXLЋMicrometers-Supersedes 39-GP-18a, August 1957 and 39-GP-18M, February 1979TLЋJЙ=Йu(Й Й|Быд=PXMЋMicrometers-Supersedes 39-GP-18a, August 1957 and 39-GP-18M, February 1979TMЋJЙ?Йv(Й Й|Быд=PXNЋMicrometers-Supersedes 39-GP-18a, August 1957 and 39-GP-18M, February 1979TNЋJЙAЙx(Й Й|Быд>PTOЋ-Vernier, Dial and Digital Calipers and Gauges`’KJ0ВыКЉ@` TPЋ-Vernier, Dial and Digital Calipers and Gauges`’KJ0ВыКЉ@` TQЋ-Vernier, Dial and Digital Calipers and Gauges[IјWїH0ВлКЉ@РTRЋ-Vernier, Dial and Digital Calipers and Gauges[IјWїH0ВлКЉ@Р~SЋInformation technology Security techniques Code of practice for information security management-Second EditionTSЋpЙGЙ(Й Й|Блд=PTTЋ-Vernier, Dial and Digital Calipers and Gauges[IјWїH0ВлКЉ@РXUЋMicrometers-Supersedes 39-GP-18a, August 1957 and 39-GP-18M, February 1979TUЋJЙJЙ…(Й Й|Блд=PVЋlVЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTVЋ^ЙLЙ‹(Й Й|Быд=PVernier. Dial and Digital Calipers and Gauges[IјWїH0ВлКЉ@РUЋXUЋMicrometers-Supersedes 39-GP-18a, August 1957 and 39-GP-18M, February 1979TUЋJЙJЙ…(Й Й|Блд=PVЋЯŒ'№?№?№?HZ™Ї(ъI№?№?№?HZ™Їž2аx$аRўЊVЎVЊVўЊRўІRњІNњЂNіЂК&в>ъVЂNРlо Š ќ Ј  Р , и x $ Ф p  ШtШp“?х‘=Чsп‹ХGѓ‡3Д`џK˜йzўК?ВФмlWЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTWЋ^КК‘(К К|Быд=P”XЋMicrobiology of Food and Animal Feeding Stuffs - General Rules for Microbiological Examinations-Second Edition; Amendment 1:04-01-2001TXЋ†КК—(К К|Быд=PdYЋRisk Management: Guideline for Decision-Makers-First Edition; General Instruction No 1TYЋVККŸ(К К|БЛд=PoZЋFood safety management systems Requirements for any organization in the food chain-First EditionTZЋaККЇ(К К|Бд=P[ЋInformation technology - Security techniques - Information security management systems - Requirements-First EditionT[ЋsККЏ(К К|Быд=Pl\ЋGeneral requirements for the competence of testing and calibration laboratories-Second editionT\Ћ^К КГ(К К|БЛд=Pl]ЋGeneral requirements for the competence of testing and calibration laboratories-Second editionT]Ћ^К КЕ(К К|БЛд=Pl^ЋGeneral requirements for uhe competence of testing and calibration laboratories-Second editionT^Ћ^ККЗ(К К|Быд=Pl_ЋGeneral requirements for the competence of testing and calibration laboratories-Second editionT_Ћ^ККЛ(К К|Буд=Pl`ЋGeneral requirements for the competence of testing and calibration laboratories-Second editionT`Ћ^ККС(К К|БЛд=P‚aЋISO GUIDE TO THE EXPRESSION OF UNCERTAINTY IN MEASUREMENT-SEE ALSO ANSI Z540.1; COMPANION DOCUMENT TO TO THE ISO VIMTaЋtККУ(К К|Блд=PlbЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTbЋ^ККЩ(К К|Бд=PlcЋGeneral requirements for the competence of testing and calibration maboratories-Second editionTcЋ^ККи(К К|БЛд=PldЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTdЋ^ККк(К К|БЛд=PleЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTeЋ^ККм(К К|Быд=PlfЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTfЋ^ККо(К К|Быд=PlgЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTgЋ^К Кр(К К|Быд=PlhЋGeneral requirements for the competence of testing and calibration laboratories-Second editionThЋ^К"Кт(К К|Быд=PliЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTiЋ^К$Кф(К К|Буд=PTjЋ1Dimensional Tolerances for Aluminum Mill ProductswH0јAJ4ВуКЉ@WkЋRequirements for Soldered Electrical and Electronic Assemblies-Revision CTkЋIК'Кь(К К|БЛд=PelЋBiolmgical Evaluation of Medical Devices - Part 1: Evaluation and Testing-Third EditionTlЋWК)К№(К К|Буд=PWmЋService Regulators for Natural Gas-Third Edition; Supersedes CGA 6.18-M85TmЋIК+Кє(К К|Бд=P–nЋStatistical Methods - Guidelines for the Evaulation of Conformity with Specified Requirements - Part 1: General Principles-First EditionTnЋ‰К-Кі(К К|Быд=PWoЋService Regulators for Natural Gas-Third Edition; Supersedes CGA 6.18-M85ToЋIК/Кј(К К|Быд=P_pЋConception Et Construction Des Foyers Et Cheminees En Maconnerie-Premiere EditionTpЋQК1К)К К|Б†д=PvqЋRecommended Practice for the Requirements and Characteristics of Documents Intended for Mptical ScanningTqЋhК3К)К К|Бд=PrЋInformation technology - Security techniques - Information security management systems - Requirements-First EditionTrЋsК5К )К К|Блд=PxsЋInformation Technology - Security Techniques - Modes of Operation for an n-Bit Block Cipher-Second EditionTsЋjК7К)К К|Б†д=PTtЋ*YARN, CORD, SLEEVING, CLOTH AND TAPE-GLASS`RSJ0ВыКЉ@` TuЋ2Methodes DДEchantillonnage Et DДEssai De La Brique]J0ВыКЉ@ˆ ЩvЋRecommended Practice for Classification of Locations for Electrical Installations at Petroleum Facilities Classified as Class I, Division 1 and Division 2-First Edition; Errata 10/17/1998TvЋЛК;К)К К|Бд=PЩwЋRecommended Practice for Classification mf Locations for Electrical Installations at Petroleum Facilities Classified as Class I, Division 1 and Division 2-First Edition; Errata 10/17/1998TwЋЛК=К)К К|Бд=PlxЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTxЋ^К?К!)К К|Б†д=PˆyЋQuality Systems - Medical Devices - Particular Requirements for the Applicauion of ISO 9002-First Edition; ISO 13488: 1996TyЋzКAК+)К К|Бд=P~zЋBiological Evaluation of Medical Devices - Part 4: Selection of Tests for Interactions with Blood-Second EditionTzЋpКCК2)К К|БЛд=P‡{ЋBiological Evaluation of Medical Devices - Part 10: Tests for Irritation and Delayed-Type Hypersensitivity-Second EditionT{ЋyКEК4)К К|БЛд=Pˆ|ЋBiological Evaluation of Medical Devices - Part 11: Tests for Systemic Toxicity First Edition; (CEN EN ISO 10993-11: 1995)T|ЋzКGК6)К К|Б†д=P}Ћ‘}ЋBiological Evaluation of Medical Devices - Part 6: Tests for Local Effects After Implantation First Edition; (CEN EN 30993-6: 1994)T}ЋƒКIК8)К К|Б†д=P|Ћˆ|ЋBiological Evaluation of Medical Devices - Part 11: Tests for Systemic Toxicity First Edition; (CEN EN ISO 10993-11: 1995)T|ЋzКGК6)К К|Б†д=P№6ўџ@Ÿ?Jž?JИž?JА8™X6‰FHŸ?J[К@ОH ъ˜HŸ?J07‰FўџЇЇш№ЊЗ/лT‚.ІRц’ЩuЌXА8фc™Eц’;чQ§ІRэ™Bюš.к n  Ў Z ю š . к n  Ў Z юšФX˜Dи„ФXƒ/РlД Ь`џI˜йD8Л@Ђ Р ~ЋBiological Evaluation of Medical Devices - Part 9: Framework for Identification and Quantification of Potential Degradation Products-First EditionT~Ћ’ЛЛ:)Л Л|Б†д=PЈЋBiological Evaluation of Medical Devices - Part 13: Identification and Quantification of Degradation Products from Polymeric Medical Devices-First EditionTЋšЛЛ=)Л Л|Б†д=P€ЋBiological evaluation of medical devices Part 3: Tests for genotoxicity, carcinogenicity and reproductive toxicity-Second EditionT€Ћ‚ЛЛA)Л Л|Буд=PuЋBiological evaluation of medical devices Part 18: Chemical characterization of materials-First EditionTЋgЛЛC)Л Л|БЛд=P‘‚ЋBiological Evaluation of Medical Devices - Part 16: Toxicokinetic Study Design for Degradation Products and Leachables-First EditionT‚Ћ„ЛЛE)Л Л|БЛд=PЧƒЋMedical electrical equipment Part 1-2: General requirements for safety Collateral standard: Electromagnetic compatibility Requirements and tests-Second Edition; IEC 60601-1-2:2001TƒЋЙЛ ЛI)Л Л|Буд=PЧ„ЋMedical electrical equipment Part 1-2: General requirements for safety Collateral standard: Electromagnetic compatibility Requirements and tests-Second Edition; IEC 60601-1-2:2001T„ЋЙЛ ЛK)Л Л|Блд=PЧ…ЋMedical electrical equipment Part 1-2: General requirements for safety Collateral standard: Electromagnetic compatibility Requirements and tests-Second Edition; IEC 60601-1-2:2001T…ЋЙЛЛM)Л Л|БЛд=Pƒ†ЋQuality Management Systems - Fundamentals and Vocabulary-Second Edition; Supersedes ISO 9000-1:1994 and ISO 8402:1994T†ЋuЛЛR)Л Л|Быд=PT‡ЋQuality Management Systems - Fundamentals and Vocabulary-Third EditionT‡ЋFЛЛT)Л Л|Быд=PY™ЋWind Turbine Generator Systems - Part 1: Safety Requirements-Second EditionT™ЋKЛЛr)Л Л|Б†д=PxšЋRecords Management Part 2: Guidelines-ISO 15489.2: 2002; Supersedes in Part AS 4390.1 Thru AS 4390.6: 1996TšЋjЛЛw)Л Л|Буд=P`›ЋInformation and Documentation - Records Management - Part 1: General-First EditionT›ЋRЛЛy)Л Л|Буд=PoœЋFood safety management systems Requirements for any organization in the food chain-First EditionTœЋaЛЛ})Л Л|Бд=PoЋFood safety management systems Requirements for any organization in the food chain-First EditionTЋaЛЛ)Л Л|Бд=PožЋFood safety management systems Requirements for any organization in the food chain-First EditionTžЋaЛЛ)Л Л|Бд=PzŸЋTeleprotection Equipment of Power Systems - Performance and Testing - Part 1: Command Systems-Second EditionTŸЋlЛ Л…)Л Л|БЛд=P„ ЋDirect Reduced Iron - Sampling and Sample Preparation - Manual Methods for Reduced Pellets and Lump Ores First EditionT ЋvЛ"Л‰)Л Л|Буд=P„ЁЋDirect Reduced Iron - Sampling and!Sample Preparation - Manual Methods for Reduced Pellets and Lump Ores First EditionTЁЋvЛ$Л‹)Л Л|Буд=P†ЂЋPlugs and socket-outlets for household and similar purposes - Part 2: Particular requirements for adaptors-First EditionTЂЋxЛ&ЛŽ)Л Л|Буд=P“ЃЋProject 25 Trunking Control Channel Formats New Technology Standards Project Digital Radio Technical Standards-Uqgrade of TSB102.AABBTЃЋ…Л(Л’)Л Л|Блд=PwЄЋMachinery for Forestery - Tracked Special Machines - Performance Criteria for Brake Systems First EditionTЄЋiЛ*Л—)Л Л|Бд=PЉЅЋMethods for the calibration of vibration and shock transducers - Part 21: Vibration calibration by comparison to a reference transducer (ISO 16063-21:2003)TЅЋ›Л,ЛЁ)Л Л|БЛд=P–ІЋMethods for the calibration of vibration and shock transducers Part 22: Shock calibration by comparison to a reference transducer-:1994TІЋˆЛ.ЛЃ)Л Л|БЛд=PdЇЋRisk Management: Guideline for Decision-Makers-First Edition; General Instruction No 1TЇЋVЛ0ЛЇ)Л Л|Блд=PdЈЋRisk Management: Guideline for Eecision-Makers-First Edition; General Instruction No 1TЈЋVЛ2ЛЉ)Л Л|Блд=PTЉЋ(General Use Power Supplies-Third Edition`J0В†КЉ@` lЊЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTЊЋ^Л5ЛА)Л Л|Буд=PlЋЋGeneral requirements for the competence of testing and calibration laboratories-Secmnd editionTЋЋ^Л7ЛВ)Л Л|Буд=PlЌЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTЌЋ^Л9ЛД)Л Л|Буд=Pl­ЋGeneral requirements for the competence of testing and calibration laboratories-Second editionT­Ћ^Л;ЛЖ)Л Л|Б†д=P”ЎЋMicrobiology of Fooe and Animal Feeding Stuffs - General Rules for Microbiological Examinations-Second Edition; Amendment 1:04-01-2001TЎЋ†Л=ЛК)Л Л|БЛд=PWЏЋManagement Environnemental - Analyse Du Cycle De Vie - Principes Et CadreTЏЋIЛ?ЛО)Л Л|БЛд=PWАЋManagement Environnemental - Analyse Du Cycle De Vie - Principes Et CadreTАЋIЛAЛР)Л Л|Бд=PWБЋManagement Environnemental - Analyse Du Cycle De Vie - Principes Et CadreTБЋIЛCЛТ)Л Л|Буд=P]ВЋMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TВЋOЛEЛХ)Л Л|БЛд=PГЋ^ГЋUL Standard for Safety Ground-Fault Sensing and Relaying Equipment-Sixth EditionTГЋPЛGЛЩ)Л Л|Б†д=Pt CadreTБЋIЛCЛТ)Л Л|Буд=PВЋ]ВЋMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TВЋOЛEЛХ)Л Л|БЛд=PtJxztJ xtJф†$ЧsШqЦrоŠЪ^ žJоŠ6в~Ц0м3пh-ЇSЯ{їЃ)е f  Ѓ O р Œ , и ` Г _ З4рХўЊу§Љ4рPќT`џJ˜йN,МB2"DYДЋMountaineering equipment - Harnesses - Safety requirements and test methodsTДЋKММЭ)М М|Бд=PTЕЋKNIVES, MICROTOMEВ—G0 D ht)IXf)ItВt)I,Г‡™Gа(D]ЖЋMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TЖЋOММй)М М|БЛд=PdЗЋProtective Clothing - Assessment of Resistance of Materials to Molten Metal Splash (N)TЗЋVММс)М М|Блд=PИЋProject 25 Digital Radio Over-The-Air Reketing (OTAR) Protocol Addendum 2 - Data Link Independent OTAR-Addendum 2TИЋqММх)М М|БЛд=PYЙЋMountaineering equipment - Harnesses - Safety requirements and test methodsTЙЋKМ Мы)М М|Быд=PqКЋQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TКЋcМ Мя)М М|Бд=PlЛЋISO 9000 Essentials a Practical Handbook for Implementing the ISO 9000 Standards-Third EditionTЛЋ^М Мї)М М|Бд=P‚МЋSizing, Selection, and Installation of Pressure-Relieving Devices in Refineries Part II - Installation-Fifth EditionTМЋtММ§)М М|Буд=PTНЋ,Forged Fittings, Socket-Welding and ThreadedTОЋ4Malleable Iron Threaded Fittings Classes 150 and 300PПЋDuctile Iron Pipe Flanges and Flanged Fittings Classes 150 and 300TПЋBММ*М М|Буд=PwРЋRipe Flanges and Flanged Fittings NPS 1/2 Through NPS 24 Metric/Inch Standard-Revision of ASME B16.5-1996TРЋiММ*М М|Буд=PwСЋPipe Flanges and Flanged Fittings NPS 1/2 Through NPS 24 Metric/Inch Standard-Revision of ASME B16.5-1996TСЋiММ*М М|Буд=PЎТЋVoltage characteristics of electricity supplied by public distribution systems-CORR 15022: March 13, 2004;"CORR 15181: May 19, 2004; CORR 15390: October 4, 2004TТЋ ММ *М М|Бд=PTУЋ/Conception accessible pour l environnement bтti`2мJ0ВКЉ@` ЄФЋSpecification for Quality Programs for the Petroleum, Petrochemical and Natural Gas Industry-Seventh Edition; Errata: August 2003/ISO TS29001 AdoptionTФЋ–ММ*М М|Б†д=P_ХЋSpecification for Drill Throvgh Equipment Rotating Control Devices-First EditionTХЋQММ*М М|БЛд=PlЦЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTЦЋ^М М*М М|БЛд=PTЧЋRemanufactured Toner Cartridges`ВиJ0ВыКЉ@` TШЋRemanufactured Toner Cartridges`ВиJ0ВыКЉ@` TЩЋRemanufactured Toner Cartridges`ВиJ0ВыКЉ@` ЉЪЋGuide for Information Technology - System Definition - Concept of Operations (ConOps) Document-IEEE Computer Society Document; Incorporates IEEE 1362a-1998TЪЋ›М%М,*М М|БЛд=P~ЫЋInformation technology Security techniques Code of practice for information security management-Second EditionTЫЋpМ'М9*М М|Блд=PmнЋInformation Technology - Software Life Cycle Processes - Configuration Management-First EditionTнЋ_М)М[*М М|Бд=PoоЋFood safety management systems Requirements for any organization in the food chain-First EditionTоЋaМ+Мe*М М|БЛд=PoпЋFood safety management systems Requirements for any organization in the food chain-First FditionTпЋaМ-Мg*М М|БЛд=PqрЋQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TрЋcМ/Мk*М М|Блд=P€сЋContact lenses and contact lens care products Vocabulary Part 1: Contact lenses-First Edition; Replaces ISO 8320TсЋrМ1Мo*М М|Блд=PЙтЋContact Lenses and Contact Lens Care Products - Vocabulary - Part 2: Contact Lens Care Products-First Edition; Together with ISO 8320-1, Cancels and Replaces ISO 8320:1986TтЋЋМ3Мq*М М|Блд=P€уЋContact lenses and contact lens care products Vocabulary Part 1: Contact lenses-First Edition; Replaces ISO 8320TуЋrМ5Мs*М М|Б†д=P~фЋInformation technology Securjty techniques Code of practice for information security management-Second EditionTфЋpМ7Мx*М М|Бд=P~хЋInformation technology Security techniques Code of practice for information security management-Second EditionTхЋpМ9Мz*М М|Бд=P~цЋInformation technology Security techniques Code of practice for information security management-Second EditionTцЋpМ;М~*М М|Бд=P—чЋAcoustics - Measurement at the OperatorДs Position of Noise Emitted by Earth-Moving Machinery - Stationary Test Conditions-Second EditionTчЋ‰М=М‚*М М|Блд=P—шЋAcoustics - Measurement at the OperatorДs Position of Noise Emitted by Earth-Moving Machinery - Stationary Test Conditions-Second EditionTшЋ‰М?М„*М М|Блд=P—щЋAcoustics - Measurement at the OperatorДs Position of Noise Emitted by Earth-Moving Machinery - Stationary Test Conditions-Second EditionTщЋ‰МAМ†*М М|Блд=P{ъЋMeasurement Management Systems - Requirements for Measurement Processes and Measuring Equipment-First EditionTъЋmМCМ‰*М М|Буд=PTыЋ/Standard for Elecvrical Safety In the Workplace`’fK0ВуКЉ@` ЄьЋUnderground Installation of Flexible Glass-Reinforced Thermosetting Resin (GRP) Pipes - Part 2: Comparison of Static Calculation Methods-First EditionTьЋ–МFМ˜*М М|Буд=PэЋЄэЋUnderground Installation of Flexible Glass-Reinforced Thermosetting Resin (GRP) Pipes - Part 2: Comparison of Static Calculation Methods-First EditionTэЋ–МHМš*М М|Буд=Ping Resin (GRP) Pipes - Part 2: Comparison of Static Calculation Methods-First EditionTьЋ–МFМ˜*М М|Буд=PЛJ№?и€™ ]Тѕ(\ѓ?фJчvЕ]@ˆУ@№ hр˜0РH(0 D0РH˜,р˜уУJXвH!и4в.к† З Ь5сJіx$ІRд€ЌѓŸЫZ—Cд€ПAэD№ œ H є ˆ 4 е  н ‰ 5 ‡ 3 МhёMљЅQЯ{ЛJіIЪvОa Й`џJ˜йљНCnЄюЋUnderground Installation of Flexible Glass-Reinforced Thermosetting Resin (GRP) Pipes - Part 2: Comparison of Static Calculation Methods-First EditionTюЋ–ННœ*Н Н|Буд=PЄяЋUnderground Installation of Flexible Glass-Reinforced Thermosetting Resin (GRP) Pipes - Part 2: Comparison of Static Calculation Methods-First EditionTяЋ–ННž*Н Н|Блд=PЄ№ЋUnderground Installation of Flexible Glass-Reinforced Thermosetting Resin (GRP) Pipes - Part 2: Comparison of Static Calculation Methods-First EditionT№Ћ–ННЂ*Н Н|Буд=PЄёЋUnderground Installation of Flexible Glass-Reinforced Thermosetting Resin (GRP) Pipes - Part 2: Comparison of Static Calculation Methods-First EditionTёЋ–ННІ*Н Н|Б†д=PђЋTentative Method of Extended Analysis for Natural Gas and Similar Gaseous Mixtures by Temperature Programmed Gas ChromatographyTђЋНН­*Н Н|Блд=PlѓЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTѓЋ^Н НБ*Н Н|Б†д=PlєЋGeneral requiremfnts for the competence of testing and calibration laboratories-Second editionTєЋ^Н НГ*Н Н|БЛд=PlѕЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTѕЋ^ННЗ*Н Н|Бд=P‰іЋMedical devices Quality management systems Guidance on the application of ISO 13485:2003-First Edition; ISO/TR 14969:2004TіЋ{ННЛ*Н Н|Блд=PTїЋ9Specification for Welding of Presses and Press ComponentsЉ@` TјЋ9Specification for Welding of Presses and Press ComponentsЉ@` TљЋ9Specification for Welding of Presses and Press ComponentsЉ@` lњЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTњЋ^ННб*Н Н|Быд=PTћЋ)Recyclability Guidelines-Engl; Revision C@ ZK ZK€ЂZK8ВлlќЋGeneral requirements for the competence of testing and calibration laboratories-Second editionTќЋ^ННй*Н Н|БЛд=Pl§ЋGeneral requirements for the competence of testing and calibration laboratories-Second editionT§Ћ^ННл*Н Н|БЛд=PОўЋWater Quality - Determination of thf Inhibition of the Mobility of Daphnia Magna Straus (Cladocera, Crustacea) - Acute Toxicity Test-Third Edition; Technical Corrigendum 1-1998TўЋАННо*Н Н|Бд=P~џЋInformation technology Security techniques Code of practice for information security management-Second EditionTџЋpННт*Н Н|Б†д=PЄЌSpecification for Quality Programs for the Petroleum, Petrochemjcal and Natural Gas Industry-Seventh Edition; Errata: August 2003/ISO TS29001 AdoptionTЌ–Н Нш*Н Н|Бд=P_ЌSpecification for Drill Through Equipment Rotating Control Devices-First EditionTЌQН"Нъ*Н Н|Бд=PlЌGeneral requirements for the competence of testing and calibration laboratories-Second editionTЌ^Н$Нё*Н Н|Буд=PTЌ.STANDARD REQUIREMENTS FOR PRODUCTION MATERIALSJ,ГЛ‡™GаˆIKTЌ.STANDARD REQUIREMENTS FOR PRODUCTION MATERIALS`rјI0ВКЉ@` TЌ.STANDARD REQUIREMENTS FOR PRODUCTION MATERIALS`rјI0ВКЉ@` TЌ.STANDARD REQUIREMENTS FOR PRODUCTION MATERIALS`rјI0ВКЉ@` TЌ.STANDARD REQUIREMENTS FOR PRODUCTION MATERIALS`rјI0ВКЉ@` БЌSampling procedures for inspection by attributes"- Part 5 : system of sequential sampling plans indexed by acceptance quality limit (AQL) for lot-by-lot inspectionTЌЃН+Н+Н Н|Бд=PОЌSampling procedures for inspection by attributes - Part 5: System of sequential sampling plans indexed by acceptance quality limit (AQL) for lot-by-lot inspection-First EditionTЌАН-Н!+Н Н|Блд=PgЌEurocode 3: Design of stefl structures Part 1-9: Fatigue-Supersedes DD ENV 1993-1-1:1992TЌYН/Н%+Н Н|БЛд=PgЌEurocode 3: Design of steel structures Part 1-9: Fatigue-Supersedes DD ENV 1993-1-1:1992TЌYН1Н'+Н Н|БЛд=PgЌEurocode 3: Design of steel structures Part 1-9: Fatigue-Supersedes DD ENV 1993-1-1:1992TЌYН3Н)+Н Н|БЛд=P˜ЌInformation to Assist Forestry Organizations in the Use of Environmental Management System Standards ISO 14001 and ISO 14004-First EditionTЌŠН5Н/+Н Н|Бд=P]ЌDental Handpieces - Part 2: Straight and Geared Angle Handpieces Second EditionTЌOН7Н3+Н Н|Бд=P] ЌDental Handpieces - Part 2: Straight and Geared Angle Handpieces Second EdivionT ЌOН9Н5+Н Н|Бд=P]!ЌDental Handpieces - Part 2: Straight and Geared Angle Handpieces Second EditionT!ЌOН;Н6+Н Н|Бд=P]"ЌDental Handpieces - Part 2: Straight and Geared Angle Handpieces Second EditionT"ЌOН=Н8+Н Н|Бд=Pw#ЌSoftware engineering Guidelines for the application of JSO 9001:2000 to computer software-First Edition;T#ЌiН?Н=+Н Н|Буд=P}$ЌQuality Management Systems - Guidelines for Performance Improvements-Second Edition; Supersedes ISO 9004-1:1994T$ЌoНAНC+Н Н|Быд=Pq%ЌQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T%ЌcНCНE+Н Н|Быд=PT&ЌQuality Management Systems - Fundamentals and Vocabulary-Third EditionT&ЌFНEНG+Н Н|Быд=PT'Ќ(Resistance Welding Manual-Fourth Edition`2аK0ВуКЉ@` T(Ќ.STANDARD REQUIREMENTS FOR PRODUCTION MATERIALS`вТK0В†КЉ@` )Ќ)ЌInformation technology - Security techniques - Information security management systems - Requirements-First Editionocabvlary-Third EditionT&ЌFНEНG+Н Н|Быд=PT'Ќ(Resistance Welding Manual-Fourth Edition`2аK0ВуКЉ@` T(Ќ.STANDARD REQUIREMENTS FOR PRODUCTION MATERIALS`вТK0В†КЉ@` пuK№?€пšђ?ДOK ~B‡ё?рДOKZiebellZandstraYuuK№?Wong№?Wingett §kK`џtKруuKxТnЦU„0ЙeДWІRѕЁ ЕNњ“?и„ЦrСmХqЩ] ЊVВ ^ р Œ Ю z  К N њ І : ц’>ъa ЁMс!Э@ьHєPќX`џJ˜й<>ОDЋM€ST)ЌsНIV+О О|Б†д=PT*Ќ=Graphical Symbols for Use in the Labelling of Medical Devicesi‚IT+Ќ=Graphical Symbols for Use in the Labelling of Medical Devicesi.IT,Ќ=Graphical Symbols for Use in the Labelling of Medical Devicesi.IT-Ќ=Graphical Symbols for Use in the Labelling of Medical Devicesi.IT.Ќ=Graphical Symbols for Use in the Labelling of Medical Devicesi.I/ЌGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558T/ЌѓООe+О О|БЛд=P0ЌGeneral Specification for Electrical/Electronic Component Analytical-Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558T0ЌѓООg+О О|Быд=PU1ЌCommercial Building Standard for Telecommunications Pathways and SpacesT1ЌGО Оm+О О|БЛд=PT2Ќ=Graphical Symbols for Use in the Labelling of Medical Devices T3Ќ=Graphical Symbols for Use in the Labelling of Medical Devices T4Ќ=Graphical Symbols for Use in the Labelling of Medical Devices ‰5ЌPiston-Operated Volumetric Apparatus - Part 6: Gravimetric Methods for the Determination of Measurement Error-First EditionT5Ќ{ОО{+О О|Буд=P‰6ЌPiston-Operated Volumetric Apparatus - Part 6: Gravimetric Methods for the Determination of Measurement Error-First EditionT6Ќ{ОО}+О О|Буд=Pz7ЌEnvironmental Management Systems - Specification with Guidance for Use-First Edition; CEN EN ISO 14001: 1996T7ЌlОО€+О О|Буд=P…8ЌPiston-Operated Volumetric Apparatus - Part 1: Terminology, General Requirements and User Recommendations-First EditionT8ЌwОО…+О О|Быд=PU9ЌPiston-Operated Volumetric Apparatus - Part 5: Dispensers-First EditionT9ЌGОО‡+О О|Б†д=PU:ЌPiston-Operated Volumetric Apparatus - Part 5: Dispensers-First EditionT:ЌGОО‰+О О|Б†д=PZ;ЌPiston-Operated Volumetric Apparatus - Part 2: Piston Pipettes-First EditionT;ЌLООŠ+О О|Б†д=PZ<ЌPiston-Operated Volumetric Apparatus - Part 2: Piston Pipettes-First EditionT<ЌLООŒ+О О|Бд=Pl=ЌGeneral requirements for the competence of testing and calibration laboratories-Second editionT=Ќ^ОО’+О О|Буд=Pl>ЌGeneral requirements for the competence of testing and calibration laboratories-Second editionT>Ќ^О!О”+О О|Буд=Pl?ЌGeneral requirements for the competence of testing and calibration laboratories-Second editionT?Ќ^О#О+О О|Блд=Pl@ЌGeneral requirements for the competence of testing and calibration laboratories-Second editionT@Ќ^О%ОŸ+О О|Блд=P]AЌMicrofilm and Electronic Images as Documentary Evidence-Amemdment 1: April 2000TAЌOО'ОЂ+О О|Б†д=PЧBЌMeasurement management systems Requirements for measurement processes and measuring equipment-First Edition; ISO 10012: 2003; Replaces ISO 10012-1-97-CAN/CSA and ISO 10012-2-98-CAN/CSATBЌЙО)ОІ+О О|БЛд=PЧCЌMeasurement management systems Requirements for measurement processes and measuring equipment-First Edition; IQO 10012: 2003; Replaces ISO 10012-1-97-CAN/CSA and ISO 10012-2-98-CAN/CSATCЌЙО+ОЈ+О О|БЛд=PTDЌ*Electronic Records as Documentary Evidence ЧEЌMeasurement management systems Requirements for measurement processes and measuring equipment-First Edition; ISO 10012: 2003; Replaces ISO 10012-1-97-CAN/CSA and ISO 10012-2-98-CAN/CSATEЌЙО.ОЌ+О О|Б†д=PlFЌGeneral requirements for the competence of testing and calibration laboratories-Second editionTFЌ^О0ОА+О О|БЛд=P†GЌElectronic imaging Information stored electronically Recommendations for trustworthiness and reliability-First EditionTGЌxО2ОД+О О|Б†д=PHЌDocument management - Electronic document file format for long-term preservation - Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionTHЌО4ОЖ+О О|Буд=PTIЌ7Quality Management Systems - Requirements-Third EditionКЉ@` ‰[ЌFat and oil derivatives - Fatty Acid Methyl Esters (FAME) - Determination of ester and linolenic acid methyl ester contentsT[Ќ{О7Ол+О О|Б†д=Pg\ЌFat and oil derivatives - Fatty Acid Methyl Esters (FAME) - Determination of iodine valueT\ЌYО9Он+О О|Бд=Pk]ЌFat and oil derivatives - Fatty Acid Methyl Esters (FAME) - Determination of methanol contentT]Ќ]О;Оп+О О|Буд=PЇ^ЌFat and oil derivatives - Fatty Acid Methyl Esters (FAME) - Determination of phosphorus content by inductively coupled plasma (ICP) emission spectrometryT^Ќ™О=Ос+О О|Буд=P‹_ЌFat and oil derivatives - Fatty Acid Methyl Esters (FAME) - Determination of oxidation stability (accelerated oxidation test)T_Ќ}О?Оу+О О|БЛд=Ps`ЌAutomotive fuels - Fatty acid methyl esters (FAME) for diesel engines - Requirements and test methodsT`ЌeОAОщ+О О|Блд=PTaЌ Safety ColorsВ†—E0`)I hєaKXцaKtВ†єaK,Г†‡™Gаh)ITbЌ Safety ColorsВ†—G0`)I hєaKXцaKtВ†єaK,Г†‡™Gаh)ITcЌUniform Fire Code-2006 EditionРSXL0ВКЉ@ј TdЌPersonal Protection - Protective Footwear-and; Now Copyrighted by ASTMTdЌFОFОѕ+О О|Бд=PTeЌ3Safety Standard for Conveyors and Related EquipmentL0ВКЉ@ј fЌcfЌIndustrial Unit-Type First Aid Kits, Minimum Requirements for-Now Copyrighted by ISEAРSXL0ВКЉ@ј dЌTdЌPersonal Protection - Protective Footwear-and; Now Copyrighted by ASTMTdЌFОFОѕ+О О|Бд=PTeЌ3Safety Standard for Conveyors and Related EquipmentL0ВКЉ@ј лy%б})еК/л4рu!Кfн‰5ІRЬx ИёI‚.gЖbіЂ6т v " Ж b  Д Z  Б ]  Д / лa „0ЇSџЋWЎ­YXА\Д`џJ˜й><ПDbAё-TfЌUОIљ+П П|БЛд=PwgЌAmerican National Standard for Machine Tools Performance Criteria for Safeguarding-Replaces ANSI B11.19TgЌiППќ+П П|Буд=PThЌ1Safety Standard for Low Lift and High Lift Trucks2TL0ВуКЉ@` ~iЌInformation technology Security techniques Code of practice for information security management-Second EditionTiЌpПП,П П|Бд=P~jЌInformation technology Security techniques Code of practice for information security management-Second EditionTjЌpПП,П П|Бд=P~kЌInformation technology Security techniques Code of practice for information security management-Second EditionTkЌpПП ,П П|Бд=PTlЌ1Dimensional Tolerances for Aluminum Mill Products%L%LР %L8ВЛTmЌ1Dimensional Tolerances for Aluminum Mill Products%L%LР %L8ВЛTnЌ5Earth-Moving Machinery - Access Systems Fifth EditionГу‡™GаЈГDcoЌEarth-Moving Machinery - OperatorДs Field of View - Part 1: Test Method First EditionToЌUП П,П П|Буд=PipЌEarth-Moving Machinery - OperatorДs Field of View - Part 2: Evaluation Method First EditionTpЌ[ПП,П П|БЛд=P`qЌEarth-Moving Machinery - OperatorДs Field of View - Part 3: Criteria First EditionTqЌRПП,П П|БЛд=PКrЌEarth-Moving Machinery - Roll-Over Protective Structures - Laboratory Tests and Performance Requirements-First Edition; Amendment 1-1997; Technical Corrigendum 1 12/01/2000TrЌЌПП,П П|БЛд=PТsЌRollover Protective Structures (ROPS) for Agricultural, Construction, Earthmoving, Forestry, Industrial, and Mining Machines - Part 1: General Requirements-General Instruction No 1TsЌДПП ,П П|БЛд=PТtЌRollover Protective Structures (ROPS) for Agricultural, Construction, Earthmoving, Forestry, Industrial, and Mining Machines - Part 1: General Requirements-General Instruction No 1TtЌДПП",П П|Быд=PTuЌ7Hazardous Industrial Chemicals - Precautionary LabelingКЉ@` XvЌHazardous Industrial Chemicals - Material Safety Data Sheets - PreparationTvЌJПП(,П П|Бд=PXwЌHazardous Industrial Chemicals - Material Safety Data Sheets - Preparation TwЌJПП*,П П|Бд=PЌxЌLiquid Flow Measurement in Open Channels - Velocity-Area Methods - Collection and Processing of Data for Determination of Errors in Measurement-Second EditionTxЌžПП5,П П|Б†д=PЌyЌLiquid Flow Measurement in Open Channels - Velocity-Area Methods - Collection and Processing of Data for Determination of Errors in Measurement-Second Edition TyЌžП П7,П П|Быд=PЌzЌLiquid Flow Measurement in Open Channels - Velocity-Area Methods - Collection and Processing of Data for Determination of Errors in Measurement-Second EditionTzЌžП"П9,П П|Быд=PЌ{ЌLiquid Flow Measurement in Open Channels - Velocity-Area Methods - Collection and Processing of Data for Determination of Errors in Measurement-Second Edition T{ЌžП$П=,П П|Быд=PЌ|ЌLiquid Flow Measurement in Open Channels - Velocity-Area Methods - Collection and Processing of Data for Determination of Errors in Measurement-Second EditionT|ЌžП&П?,П П|Быд=Pl}ЌGeneral requirements for the competence of testing and calibration laboratories-Second editionT}Ќ^П(ПD,П П|Буд=Pl~ЌGeneral requirements for the competence of testing and calibration laboratories-Second editionT~Ќ^П*ПH,П П|Буд=PjЌSteel - Conversion of Elongation Values - Part 1: Carbon and Low Alloy Steels-Second EditionTЌ\П,ПL,П П|Буд=Pj€ЌSteel - Conversion of Elongation Values - Part 1: Carbon and Low Alloy Steels-Second EditionT€Ќ\П.ПN,П П|Буд=PjЌSteel - Conversion of Elongation Values - Part 1: Carbon and Low Alloy Steels-Second EditionTЌ\П0ПO,П П|Буд=Pj‚ЌSteel - Conversion of Elongation Values - Part 1: Carbon and Low Alloy Steels-Second EditionT‚Ќ\П2ПQ,П П|Буд=PjƒЌSteel - Conversion of Elongation Valueq - Part 1: Carbon and Low Alloy Steels-Second EditionTƒЌ\П4ПR,П П|Буд=Pj„ЌSteel - Conversion of Elongation Values - Part 1: Carbon and Low Alloy Steels-Second EditionT„Ќ\П6ПT,П П|Буд=Pj…ЌSteel - Conversion of Elongation Values - Part 1: Carbon and Low Alloy Steels-Second EditionT…Ќ\П8ПU,П П|Бсд=Pj†ЌSteel - Conversion of Elongation Values - Part 1: Carbon and Low Alloy Steels-Second EditionT†Ќ\П:ПY,П П|Буд=Pl‡ЌGeneral requirements for the competence of testing and calibration laboratories-Second editionT‡Ќ^П<П],П П|Б†д=PlˆЌGeneral requirements for the competence of testing and calibration laboratories-Second editionTˆЌ^П>П_,П П|БЛд=Pl‰ЌGeneral requirements for the competence of testing and calibration laboratories-Second editionT‰Ќ^П@Пa,П П|БЛд=PlŠЌGeneral requirements for the competence of testing and calibration laboratories-Second editionTŠЌ^ПBПc,П П|БЛд=Po‹ЌFood safety management systems Requirements fmr any organization in the food chain-First EditionT‹ЌaПDПg,П П|БЛд=PTŒЌ7ABBR Abbreviations for Scientific and Engineering TermsКЉ@И TЌ7ABBR Abbreviations for Scientific and Engineering TermsКЉ@И TŽЌ7ABBR Abbreviations for Scientific and Engineering TermsКЉ@И ЌЌЌFoodstuffs Methods of analysis for the detection of genetically modified organisms and derived pqoducts Qualitative nucleic acid based methods-First Edition|БЛд=PTŒЌ7ABBR Abbreviations for Scientific and Engineering TermsКЉ@И TЌ7ABBR Abbreviations for Scientific and Engineering TermsКЉ@И TŽЌ7ABBR Abbreviations for Scientific and Engineering TermsКЉ@И @†,L№‘,Lџџџџџџџџ.к†2УoЏCяƒ/УoБGѓ‰5Ыw ЙOћ‘=гПSџSџSџSџ S џ S џ Ї S ћ Ї S ‘ = {'mЙeќЈEёIѕw#ЅQг+Д`џG˜йeРl‚TЩ6WCъEР Р|Бд=PЪ6General Requirements for Bodies Operating Product Certification Systems-First Edition; Cancels and Replaces ISO/IEC Guide 40: 1983TЪ6‚РРёEР Р|Бд=PTЫ6)Structural Welding Code - Stainless Steel€”tF0ВКЉ@8 )Ь6Structural Standard for Antenna Supporting Structures and Antennas-EFFECTIVE JANUARY 1, 2006; Includes County Listing 07/20/2005 after TIA-222-G standard - Please contact Global Engineering Documents (1-800-447-3352 ext.4960) for a electronic version of the 07/20/2005 County ListingTЬ6РРћEР Р|Бд=P)Э6Structural Standard for Antenna Supporting Structures and Antennas-EFFECTIVE JANUARY 1, 2006; Includes County Listing 07/20/2005 after TJA-222-G standard - Please contact Global Engineering Documents (1-800-447-3352 ext.4960) for a electronic version of the 07/20/2005 County ListingTЭ6РРџEР Р|Бд=P)Ю6Structural Standard for Antenna Supporting Structures and Antennas-EFFECTIVE JANUARY 1, 2006; Includes County Listing 07/20/2005 after TIA-222-G standard - Please contact Global Engineering Documents (1-800-447-3352 ext.4960) for a electronic version of the 07/20/2006 County ListingTЮ6РРFР Р|Бд=PmЯ6ESTANDAR DE LA INDUSTRIA UNIDA Requerimientos de Soldaduras Electricas y Ensambles ElectronicosTЯ6_Р Р FР Р|Бд=PTа6)Small craft Principal data-First editionи2еH0ВКЉ@ш nб6Small Craft - Hull Construction and Scantling - Part 4: Workshop and Manufacturing-First EditionTб6`Р РFР Р|Б‘д=Paв6Environmental management systems Requirements with guidance for use-Second EditionTв6SРРFР Р|Б‘д=PІ FSmall Craft - Stability and Buoyancy Assessment and Categorization - Part 1: Non-Sailing Boats of Hull Length Greater than or Equal to 6 m-First EditionT F˜РР$FР Р|Бд=P‘ FGeneral requirements for the competence of testing and calibration laboratories-Second edition; Technical Corrigendum 1: 08/15/2006T FƒРР,FР Р|Бд=P‘ FGeneral requirements for the competence of testing and calibration laboratories-Second edition; Technical Corrigendum 1: 08/15/2006T FƒРР0FР Р|Бд=Py FCleanrooms and Associated Controlled Environments - Part 1: Clbssification of Air Cleanliness-First EditionT FkРР8FР Р|Бд=P€FStandard Practice for Extreme Value Analysis of Nonmetallic Inclusions in Steel and Other Microstructural FeaturesTFrРРUFР Р|Б!д=PFMedical devices Quality management systems Guidance on the application of ISO 13485:2003-First Edition; Replaces ISO 14969:1999TFТР_FР Р|Бд=P~ FInformation technology Security techniques Code of practice for information security management-Second EditionT FpРРdFР Р|Бд=P|!FStandard Test Method for Microscopical Determination of Parameters of the Air-Void System in Hardened ConcreteT!FnРРhFР Р|Б!д=PT"F@ISO 9001 For Small"Business - What To Do - Advice From ISO/TC176h#FEnvironmental management Life cycle assessment Requirements and guidelines-First EditionT#FZР"РrFР Р|Бд=Pf$FEnvironmental management Life cycle assessment Principles and framework-Second EditionT$FXР$РtFР Р|Б!д=Pf%FEnvironmental management Life cycle assessment Principles and framework-Second EditionT%FXР&РvFР Р|Б!д=Pf&FEnvironmental management Life cycle assessment Principles and framework-Second EditionT&FXР(РxFР Р|Б!д=Ph'FDiagnostic Imaging and Radiation Therapy Equipment-Third Edition; General Instruction No 1T'FZР*Р|FР Р|Бд=PЋ(FMedical Electrical Equipment -"Part 1: General Requirements for Safety-General Instruction No 1; Supplement 1; 1994; Amendment 2 - February 1998; Update No 2T(FР,Р€FР Р|Б!д=P‘)FGeneral requirements for the competence of testing and calibration laboratories-Second edition; Technical Corrigendum 1: 08/15/2006T)FƒР.Р„FР Р|Бд=Pn*FSmall Craft with Inboard Engine - Propeller Shaft Ends and"Bosses with 1:10 Taper Second EditionT*F`Р0РˆFР Р|Б!д=PT+F5Small Craft - Fire-Resistant Fuel Hoses-Third Edition@Р"›”T,F;Small Craft - Toilet Waste Retention Systems-Second EditionT-F:Small Craft - Non-Fire-Resistant Fuel Hoses-Second Editionn‚.FSmall Craft with Inboard Engine - Propeller Shaft Ends and Bosses with 1:16 Taper-First Edition; Corrigendum 1: 1995T.FtР5РFР Р|Бд=PS/FSmall Craft - Steering Gear - Cable and Pulley Systems-Second EditionT/FEР7Р’FР Р|Бд=PW0FSmall Craft - Remote Steering Systems First Edition; (CEN EN 28848: 1993)T0FIР9Р”FР Р|Бд=Px1FSmall Craft - Fire Protection - Part 1: Craft with a Hull Length of up to and Includjng 15 m-First EditionT1FjР;Р–FР Р|Бд=Pg2FSmall craft Fire protection Part 2: Craft with a hull length of over 15 m-First EditionT2FYР=Р˜FР Р|Бд=Pb3FSmall Craft - Permanently Installed Fuel Systems and Fixed Fuel Tanks-Second EditionT3FTР?РšFР Р|Бд=P\4FSmall Craft - Electrican Devices - Lightning-Protection Systems-Second EditionT4FNРAРœFР Р|Бд=Pt5FSmall Craft - Liquefied Petroleum Gas (LPG) Systems-First Edition; Technical Corrigendum 1: 07/15/2001T5FfРCРžFР Р|Бд=PT6F6Small Craft - Hydraulic Steering Systems First Editiontionn7Fg7FSmall Craft - Ventilation of Petrol Engine and/or Petrol Tank"Compartments-Second Edition Р|Бд=P5Ft5FSmall Craft - Liquefied Petroleum Gas (LPG) Systems-First Edition; Technical Corrigendum 1: 07/15/2001T5FfРCРžFР Р|Бд=PT6F6Small Craft - Hydraulic Steering Systems First EditiontionnсГ…W)ћ Э Ÿ q C  ДRўŠ6к†$аiIђžKїu!Эy%Зcв~гУ] ЃOщ•-й… Е7у T € , Г _ Ю z щ • я›:цx$аcц’iь˜DД`џM˜й†рСnОЩT7FYРFЂFС С|Бд=PT8F-Small craft - Graphical symbols-First Editiont Editiontionnv9FSmall craft Less than 8 m Lengh of Hull - Determination of Maximum Propulsion Power Rating-First EditionT9FhССЇFС С|Бд=PW:FSmall Craft - Static Thrust Measurement for Outboard Motors First EditionT:FIССЉFС С|Бд=Pi;FRubber and plastics hoses for marineengine wet-exhaust systems Specification-First EditionT;F[ССЋFС С|Бд=PTF1Small Craet - Bilge-Pumping Systems-First Edition-First EditionW?FSmall Craft - Anchoring, Mooring and Towing - Strong Points-First EditionT?FIС СГFС С|Бд=PT@F:Pallets for Materials Handling - Vocabulary-Second Edition0€!GДAFReciprocating Internal Combustion Engines - Exhaust Emission Measurement - Part 4: Test Cycles for Different Engine Applications First Edition-CEN EN ISO 8178-4: 1996TAFІССТFС С|Бд=P“BFGeneral-Purpose Flat Pallets for Through Transit of Goods - Design Rating and Maximum Working Load-First Edition; Corrigendum 1: 1992TBF…ССШFС С|Бд=PpCFGeneral-Purpose Flat Pallets for Through Transit of Goods - Performance Requirements First EditionTCFbССЬFС С|Бд=PЋDFPallets fmr materials handling Flat pallets Part 1: Test methods-First Edition; Together with ISO 8611-2 and ISO 8611-3, cancels and replaces ISO 8611:1991TDFССаFС С|Бд=PEFPallets for materials handling Flat pallets Part 2: Performance requirements and selection of tests-First EditionTEFsССвFС С|Бд=PЕFFMechanical Vibration - Guidelines for the Measurement- Reporting and Evaluation of Vibration with Regard to Habitability on Passenger and Merchant Ships-Second EditionTFFЇССлFС С|Бд=P•GFConformity assessmentGeneral requirements for accreditation bodies accrediting conformity assessment bodies-Sames as ISO/IEC 17011:2004TGF‡ССпFС С|Бд=PTHFMetric Scale Rules—G0жF h”8GX†8GtВ”8G,Г‡™Gа жFTIFMetric Scale Rules`R.G0ВКЉ@` `JFInformation and Documentation - Records Management - Part 1: General-First EditionTJFRССэFС С|Бд=P`KFInformation and Documentation - Records Management - Part 1: General-First EditionTKFRС СяFС С|Бд=P`LFInformation and Documentation - Records Management - Part 1: General-First EditionTLFRС"СёFС С|Бд=P`MFInformation and Documentation - Records Management - Part 1: General-First EditionTMFRС$СєFС С|Бд=Py_FGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005T_FkС&СGС С|Бд=PT`F@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176TaF@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176TbF@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176TcF@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176TdF@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176TeF@Small craft Man-overboard prevention and recovery-First EditionTfF+Qmall Craft - OwnerДs Manual-Second Editionecovery-First EditionggFSmall Craft - Ventilation of Petrol Engine and/or Petrol Tank Compartments-Second EditionTgFYС/С2GС С|Б!д=PdhFSmall Craft - Electrical Systems - Extra-Low-Voltage d.c. Installations-Second EditionThFVС1С4GС С|Бд=PbiFSmall Craft - Permanently Installed Fuel Systems and Fixed Fuel!Tanks-Second EditionTiFTС3С6GС С|Б!д=PWjFSmall Craft - Anchoring, Mooring and Towing - Strong Points-First EditionTjFIС5С8GС С|Б!д=PakFEnvironmental management systems Requirements with guidance for use-Second Editiono FBiological Evaluation of Medical Devices - Part 5: Tests for In Vitro Cytotoxicity-Second EditionT FaС8СнGС С|Бд=P~ЁFBiological Evaluation of Medical Devices - Part 11: Test for Systemic Toxicity-First Edition; ISO 10993-11: 1993TЁFpС:СсGС С|Бд=PTЂF@Quality Assurance Requirements for Nuclear Facility ApplicationsЃFDocument management - Electronic document file format for long-term preservation - Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionTЃFС=СъGС С|Б!д=PЄFDocument management - Electronic document file format for long-term preservation - Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionTЄFС?СьGС С|Б!д=PšЅFSecurity management systems for the supply chain Best practices for implementing supply chain security Assessments and plans-First EditionTЅFŒСAС№GС С|Б!д=PyІFGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TІFkСCСєGС С|Бд=PyЇFGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TЇFkСEСїGС С|Бд=P…ЈFPiston-Operated Volumetric Apparatus - Part 1: Terminology, General Requirements and User Recommendations-First EditionTЈFwСGСћGС С|Бд=PZЉFPiston-Operated Volumetric Apparatus - Part 2: Piston Pipettes-First EditionTЉFLСIС§GС С|Бд=PZЊFPiston-Operated Volumetric Apparatus - Part 2: Piston Pipettes-First EditionTЊFLСKСџGС С|Бд=PСGСћGС С|Бд=PЉFZЉFPiston-Operated Volumetric Apparatus - Part 2: Piston Pipettes-First EditionTЉFLСIС§GС С|Бд=PЊFZЊFPiston-Operated Volumetric Apparatus - Part 2: Piston Pipettes-First Edition3) 949-1538REFERENCE & RESEARCH LABORAŒ2о„0ЋWоŠН#Я@ь] Е7уtПhВ^њІ?ы—Cя›GѓŸ&вrО j Ж V  Ў Z Х q М h ч“ш”$а=щ5с6тŽ:ц})в~Д`џJ˜й\Тnь "TkFSС7?GТ Т|Бд=P_lFSafety Requirements for Manual Turning Machines with or without Automatic ControlTlFQТТDGТ Т|Бд=P–mFInformation Processing - Volume and File Structure of CD-ROM for Information Interchange First Edition; (Corrected and Reprinted - 1988)TmFˆТТHGТ Т|Бд=P nFPaints and Varnishes - Corrosion Protection of Steel Structures by Protective Paint Systems - Part 2: Classification of Environments-First EditionTnF’ТТNGТ Т|Б!д=PToF4Environmental Management - Vocabulary-Second Edition0ВКЉ@` ŒpFDesign and installation of non-potable water systems/ Maintenance and field testing of nmn-potable water systems-First EditionTpF~ТТWGТ Т|Б!д=P`qFSoil quality - Extraction of trace elements soluble in aqua regia (ISO 11466:1995)TqFRТ Т[GТ Т|Бд=PkrFTextile Test Methods Colourfastness and Dimensional Change in Domestic Laundering of TextilesTrF]Т Т_GТ Т|Бд=P]sFCleaning/Solvent Resistance of Automotive Components During Normal Customer UseTsFOТТcGТ Т|Бд=P]tFCleaning/Solvent Resistance of Automotive Components During Normal Customer UseTtFOТТeGТ Т|Бд=PbuFTextiles - Domestic Washing and Drying Procedures for Textile Testing-Second EditionTuFTТТiGТ Т|Бд=PTvF9Task Chairs for Office Work with Visual Display TerminalsЉ@`  wFPaints and Varnishes - Corrosion Protection of Steel Structures by Protective Paint Systems - Part 2: Classification of Environments-First EditionTwF’ТТqGТ Т|Б!д=PTxF9Guide To The Use Of The Wind Load Provisions Of ASCE 7-02Љ@` ryFSpecification for Drilling and Production Hoisting Equipment-Thirteenth Edition; Addendum 1 May 2001TyFdТТGТ Т|Бд=PЪzFRecommended Practice for Procedures for Inspections, Maintenance, Repair, and Remanufacture of Hoisting Equipment-Seventh Edition/ ISO 13534 Adoption; Addendum: 11/2003; Addendum 2: 4/2005TzFМТТGТ Т|Бд=PП{FSpecification for Drilling and Production Hoisting Equipment (PSL 1 and PSL 2)-Fourth Edition; ISO 13535:2000- ISO 13535 Adoption; Addendum 1: 11/1/2004; Addendum 2: 04/15/2005;T{FБТТƒGТ Т|Б!д=P™|FSpecification for Drilling and Well Servicing Equipment-Fourth Edition; ISO 14693:12/2005 Adoption; Addendum 1: 02/2006; Addendum 2: 4/2006T|F‹ТТ…GТ Т|Бд=Pr}FSpecification for Wire Rope-Twenty-fifth Edition; ANSI/API SPEC 9A/ISO 10425:2003/ISO 10425 AdoptionT}FdТ Т‡GТ Т|Бд=PT~F+Valve Inspection and Testing-Eighth Edition`rйH0ВКЉ@` ЪFRecommended Practice for Procedures for Inspections, Maintenance, Repair, and Remanufacture of Hoisting Equipment-Seventh Edition/ ISO 13534 Adoption; Addendum: 11/2003; Addendum 2: 4/2005TFМТ#Т‹GТ Т|Б!д=PT€F/Welding Inspection and Metallurgy-First Edition`rйH0ВКЉ@` TF#Risk-Based Inspection-First Edition0Р&I0Р&I0Р&IdР&IV‚FSafety Code for Material Hoists-Second Edition; General Instruction No 1T‚FHТ'Т‘GТ Т|Б!д=PTƒF@Certification of Welding Inspection Organizations-Fourth EditionT„F2Certification of Welding Inspectors-Fourth Edition&IdР&IT…FProcess PipingВ!—G0€8G hДЭHXІЭHtВ!ДЭH,Б!‡™Gаˆ8G`†FStructural Welding Code - Steel-20th Edition; Incorporated Errata; Errata:3/3/2006T†FRТ,Т™GТ Т|Бд=PЂ‡FUse and Procedures for Inspection, Maintenance, and Repair of Drilling and Well Servicing Structures-Third Edition; Errata: 6/2004; Errata 1: 6/2004T‡F”Т.Т›GТ Т|Бд=PTˆF3Process Valve Qualification Procedure-Third Edition,Г!‡™Gаˆ8Gy‰FGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005T‰FkТ1ТЁGТ Т|Б!д=PŠFEXIGENCES GЩNЩRALES CONCERNANT LA COMPЩTENCE DES LABORATOIRES D'ЩTALONNAGES ET D'ESSAIS-Same as ISO/CEI 17025: 2005TŠFsТ3ТЋGТ Т|Б!д=Pƒ‹FInformation Technology - Software Life Cycle Processes-First Edition; Amendment 1: 5/01/2002; Amendment 2: 11/01/2004T‹FuТ5ТЏGТ Т|Бд=PTŒF1Dimensional Tolerances for Aluminum Mill Productsr"I0В!КЉ@` ”FRшgles de calcul aux щtats limites des charpentes en acier-la sixiшme щdition; Reprinted 8/2005; Incorporates Mise 1 & 2, Supplement 1TF†Т8ТЙGТ Т|Бд=P”ŽFRшgles de calcul aux щtats limites des charpentes en!acier-la sixiшme щdition; Reprinted 8/2005; Incorporates Mise 1 & 2, Supplement 1TŽF†Т:ТНGТ Т|Бд=PUЋFPiston-Operated Volumetric Apparatus - Part 5: Dispensers-First EditionTЋFGТ<ТHТ Т|Бд=P‰ЌFPiston-Operated Volumetric Apparatus - Part 6: Gravimetric Methods for the Determination of Measurement Error-First EditionTЌF{Т>СHТ Т|Бд=Py­FGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005T­FkТ@ТHТ Т|Бд=PqЎFQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TЎFcТBТ HТ Т|Бд=PrЏFDetermination of Uncertainty for Volume Measurements!Made Using the Gravimetric Method-First EditionTЏFdТDТHТ Т|Б!д=PTАF@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176TБF@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176TВF@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176ГF‘ГFGeneral requirements for the competence of testing and calibration laboratories-Second edition; Techmical Corrigendum 1: 08/15/2006F@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176TБF@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176TВF@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176РўеG˜сеG`сеG+зƒ/НiјЄ+зNњЅQНiе-ЊVеД`Оj ЖbКdМhžJі „ 0 — C „ 0 f    L јXАNњIь˜-йy%™EёQ§gД`џJ˜йlУo€DTГFƒТI%HУ У|Бд=PWДFSafety Standard for Binding and Finishing Systems-Now Copyrighted by NPESTДFIУУ-HУ У|Бд=PWЕFSafety Standard for Binding and Finishing Systems-Now Copyrighted by NPESTЕFIУУ/HУ У|Бд=P‘ЖFGeneral requirements for the competence of testing and calibration laboratories-Second edition; Technical Corrigendum 1: 08/15/2006TЖFƒУУ3HУ У|Бд=PЗFDocument management - Electronic document file format for long-term preservation - Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionTЗFУУ8HУ У|Б!д=PwИFClinical Investigation of Medical Devices for Human Subjects - Part 1: General Requirements-First EditionTИFiУ УФ{IФ Ф|Бд=Pš GDegrees of Protection Provided by Enclosures (IP Code)-Edition 2.19 Edition 2:1989 Consolidated with Amendment 1:1999; Corrigendum 1: 1/2003T GŒФ@Ф…IФ Ф|Бд=Pa!GGuide ISO 9000 Lignes Directrices Pour LДApplication Des Normes ISO 9000-3e EditionT!GSФBФŠIФ Ф|Бд=Pa"GGuide ISO 9000 Lignes Directrices Pour LДApplication Des Normes ISO 9000-3e EditionT"GSФDФŒIФ Ф}Бд=PФ@Ф…IФ Ф|Бд=P!Ga!GGuide ISO 9000 Lignes Directrices Pour LДApplication Des Normes ISO 9000-3e EditionT!GSФBФŠIФ Ф|Бд=P"Ga"GGuide ISO 9000 Lignes Directrices Pour LДApplication Des Normes ISO 9000-3e EditionГRўIЏ[ЪvзƒА_ КfС*жД7у.кˆ4f{'Y7у D № k  g  = щ n  Ц'гIѕЁMс,иZ…1ж‚)еEё`џD˜й=IХr- \*›#GGeneral Tolerances - Part 2: Geometrical Tolerances for Features without Individual Tolerance Indications-First Edition; CEN EN 22768-2: 1993T#GХХIХ Х|Бд=PT$GProduct Safety Signs and LabelsxrM0ВКЉ@H T%GCriteria for Safety SymbolsK hюFXюFtВюF,Г‡™GаˆџKІ&GGeneral Tolerances - Part 1: Tolerances for Linear and Angular Dimensions without Individual Tolerance Indications First Edition; (CEN EN 22768-1: 1993)T&G˜ХХ™IХ Х|Бд=PІ'GGeneral Tolerances - Part 1: Tolerances for Linear and Angular Dimensions without Individual Tolerance Indications First Edition; (CEN EN 22768-1: 1993)T'G˜ХХIХ Х|Б!д=Py(GCleanrnoms and Associated Controlled Environments - Part 4: Design, Construction and Start-Up-First EditionT(GkХХЁIХ Х|Б!д=Pa)GCleanrooms and associated controlled environments Part 5: Operations-First EditionT)GSХ ХЅIХ Х|Бд=P‡*GStatistics - Vocabulary and symbols - Part 1: General statistical terms and terms used in probability - (ISO 3534-1:2006)T*GyХ ХЉIХ Х|Бд=PŸ+GPlastics - Small enclosures for conditioning and testing using aqueous solutions to maintain the humidity at a constant value, (December 8, 1999)T+G‘ХХ­IХ Х|Бд=PŠ,GHydrothermal Performance of Building Materials and Products - Determination of Hygroscopic Sorption Properties-First EditionT,G|ХХЏIХ Х|Бд=PА-GManually portable agricultural and forestry machines and powered lawn and garden equipment Design principles for single-panel product safety labels-First EditionT-GЂХХГIХ Х|Бд=Pƒ.GGraphical symbols Safety colours and safety signs Part 2: Design principles for product safety labels-First EditionT.GuХХЕIХ Х|Бд=P—/GGraphical symbols Safety colours and safety signs Part 3: Design principles for graphical symbols for use in safety signs-First EditionT/G‰ХХЗIХ Х|Б!д=PR0GHigh Performance Glazed Coating System, Interior-Supersedes 1-GP-186T0GDХХНIХ Х|Бд=Py1GGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005T1GkХХТIХ Х|Бд=P‰2GPiston-Operated Volumetric Apparatus - Part 6: Gravimetric Methods for the Determination of Measurement Error-First EditionT2G{ХХЦIХ Х|Б!д=Pm3GInformation Technology - Security Techniques - Key Management - Part 1: Framework-First EditionT3G_ХХЪIХ Х|Бд=PЎ4GInformation Technology - Security Techniques - Key Management - Part 2: Mechanisms Using Symmetric Techniques-First Edition; Technical Corrigendum 1: 07/15/2005T4G Х ХЬIХ Х|Бд=PŠ5GInformation Technology - Security Techniques - Key Management - Part 3: Mechanisms Using Asymmetric Techniques-First EditionT5G|Х"ХЮIХ Х|Бд=P6GInformation technology Security vechniques Key management Part 4: Mechanisms based on weak secrets-First EditionT6GsХ$ХаIХ Х|Б!д=P‘7GGeneral requirements for the competence of testing and calibration laboratories-Second edition; Technical Corrigendum 1: 08/15/2006T7GƒХ&ХдIХ Х|Бд=Pп8GAccuracy (Trueness and Precision) of Measurement Methods and Results - Part 3: Intermediate Measures of"the Precision of a Standard Measurement Method-First Edition; Replaces ISO 5725; Corrigendum 1 10/15/2001T8GбХ(ХкIХ Х|Бд=Pп9GAccuracy (Trueness and Precision) of Measurement Methods and Results - Part 3: Intermediate Measures of the Precision of a Standard Measurement Method-First Edition; Replaces ISO 5725; Corrigendum 1 10/15/2001T9GбХ*ХмIХ Х|Бд=P№:GAbcuracy (trueness and precision) of measurement methods and results - Part 2: Basic method for the determination of repeatability and reproducibility of a standard measurement method-Premiere щdition; Corrigendum 1: 5/15/2002T:GтХ,ХоIХ Х|Бд=PfLGStandard for Automobile Theft Deterrent Equipment and Systems: Electronic ImmobilizationTLGXХ.ХJХ Х|Бд=P‘MGAmbjent air quality - Standard method for the measurement of Pb, Cd, As and Ni in the PM10 fraction of suspended particulate matterTMGƒХ0ХJХ Х|Бд=PsNGSafety of machinery. Safety related parts of control systems. Part 1 : general principles for design.TNGeХ2Х JХ Х|Бд=PsOGSafety of machinery. Safety related parts of control systems. Part 1 : general principlfs for design.TOGeХ4Х JХ Х|Бд=PsPGSafety of machinery. Safety related parts of control systems. Part 1 : general principles for design.TPGeХ6ХJХ Х|Бд=PsQGSafety of machinery. Safety related parts of control systems. Part 1 : general principles for design.TQGeХ8ХJХ Х|Бд=PsRGSafety of machinery. Safety related parts of control systems. Part 1 : general principles for design.TRGeХ:ХJХ Х|Бд=PsSGSafety of machinery. Safety related parts of control systems. Part 1 : general principles for design.TSGeХ<ХJХ Х|Бд=PЎTGPreparation of Steel Substrates Before Application of Paints and Related Products - Surface Preparation Methods - Part 2: Abrasive Blast-Cleaning-second editionTTG Х>ХJХ Х|Бд=PfUGStandard for Automobile Theft Deterrent Equipment and Systems: Electronic ImmobilizationTUGXХ@Х"JХ Х|Бд=PTVG:Safety requirements for lifting tables-(AMENDS DS/EN 1570)@8 WGЎWGPreparation of Steel Substrates Before Application of Paints and Related Products - Surface Preparation Methods - Part 2: Abrasive Blast-Cleaning-second edition Automobile Theft Deterrent Equipment and Systems: Electronic ImmobilizationTUGXХ@Х"JХ Х|Бд=PTVG:Safety requirements for lifting tables-(AMENDS DS/EN 1570)@8 ŠM0—!M ћџЇЇш№6 ћџ›9х+})Жbя›(дa šFгюš4р№œНiŠ6ЅQа|ђž№ œ / л R ў … 1 п ‹ є    ЩХ;чHєmИdы—ёїЃOћ`џH˜йрЦso cTWG ХC4JЦ Ц|Бд=PŸXGFinancial transaction card originated messages Interchange message specifications Part 1: Messages, data elements and code values-First EditionTXG‘ЦЦ:JЦ Ц|Б!д=PŸYGFinancial transaction card originated messages Interchange message specifications Part 1: Messages, data elements and code values-First EditionTYG‘ЦЦ>JЦ Ц|Бд=PŸZGFinancial transaction card originated messages Interchange message specifications Part 1: Messages, data elements and code values-First EditionTZG‘ЦЦBJЦ Ц|Бд=P‘[GGeneral requirements for the competence of testing and calibration laboratories-Second edition; Technical Corrigendum 1: 08/15/2006T[GƒЦЦNJЦ Ц|Б!д=PT\G9Electrical Standard for Industrial Machinery-2007 EditionЉ@` T]GPower Operated Pedestrian Doorsial Machinery-2007 EditionЉ@` Т^GGraphic Symbols for Electrical and Electronics Diagrams (Including Reference Designation Class Designation Letters)-CSA Z99-75; Includes supplement to ANSI 732.2-75 and IEEE 315-75T^GДЦ ЦjJЦ Ц|Бд=PO_GFIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderT_GAЦ ЦoJЦ Ц|Бд=Py`GSafety of machinery - Human physical performance - Part 3: Recommended force limits for machinery operationT`GkЦЦsJЦ Ц|Б!д=PUaGErgonomics Manual handling Part 1: Lifting and carrying-First EditionTaGGЦЦuJЦ Ц|Бд=PUbGErgonomics Manual handling Part 1: Lifting and carrying-First EditionTbGGЦЦwJЦ Ц|Бд=P`cGQuality management systems Guidelines for configuration management-Second EditionTcGRЦЦ{JЦ Ц|Бд=P“dGGuidelines for Auditing Quality Systems - Part 1: Auditing-First Edition; Cnrrected and Reprinted - 1993; Replaced by ISO 19011: 2002TdG…ЦЦ}JЦ Ц|Б!д=PОeGGuidelines for Auditing Quality Systems - Part 2: Qualification Criteria for Quality Systems Auditors-First Edition; Corrected and Reprinted - 1993; Replaced by ISO 19011: 2002TeGАЦЦJЦ Ц|Б!д=PЉfGGuidelines for Auditing Quality Systems - Part 3: Management of Audit Programmes-Fjrst Edition; Corrected and Reprinted - 1993; Replaced by ISO 19011: 2002TfG›ЦЦJЦ Ц|Бд=PTgGQuality Management Systems - Fundamentals and Vocabulary-Third EditionTgGFЦЦƒJЦ Ц|Б!д=P}hGQuality Management Systems - Guidelines for Performance Improvements-Second Edition; Supersedes ISO 9004-1:1994ThGoЦЦ…JЦ Ц|Бд=PUiGErgonomics Manual handling Part 1: Lifting and carrying-First EditionTiGGЦ!Ц‰JЦ Ц|Бд=PyjGSafety of machinery - Human physical performance - Part 3: Recommended force limits for machinery operationTjGkЦ#Ц‹JЦ Ц|Б!д=PUkGErgonomics Manual handling Part 1: Lifting and carrying-First EditionTkGGЦ%ЦJЦ Ц|Бд=PslGSafety of machinery - Safety-related parts of control systems - Part 1: General principles for designTlGeЦ'Ц“JЦ Ц|Бд=PsmGSafety of machinery - Safety-related parts of control systems - Part 1: General principles for designTmGeЦ)Ц•JЦ Ц|Бд=PsnGSafety of machinery - Safety-related parts of cnntrol systems - Part 1: General principles for designTnGeЦ+Ц—JЦ Ц|Бд=PsoGSafety of machinery - Safety-related parts of control systems - Part 1: General principles for designToGeЦ-Ц˜JЦ Ц|Бд=PqpGQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TpGcЦ/ЦœJЦ Ц|Бд=PTqG;INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-10th Edition` yrGGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TrGkЦ2ЦЇJЦ Ц|Бд=PsGRecommended Practices for the Welding of Rails and Related Rail Components for Use by Rail Vehicles-Errata: 07/2005TsGsЦ4ЦЋJЦ Ц|Б!д=P‚tGISO GUIDE TO THE EXPRESSION OF UNCERTAINTY IN MEASUREMENT-SEE ALSO ANSI Z540.1; COMPANION DOCUMENT TO TO THE ISO VIMTtGtЦ6ЦЏJЦ Ц|Бд=PŸ†GErgonomics of the thermal environment Methods for the assessment of human responses to contact with surfaces Part 1: Hot surfaces-First EditionT†G‘Ц8ЦЯJЦ Ц|Бд=PМ‡GConformity assessment Requirfments for bodies providing audit and certification of management systems-First Edition; Replaces ISO/IEC Guide 62:1996 and ISO/IEC Guide 66:1999T‡GЎЦ:ЦдJЦ Ц|Бд=P…ˆGGraphical Symbols for Use on Equipment - Part 1: Overview and Application-Third Edition (DATABASE SNAPSHOTS:10/06/2006)TˆGwЦ<ЦиJЦ Ц|Бд=P…‰GGraphical Symbols for Use on Equipment - Part 1: Overview and Application-Third Edition (DATABASE SNAPSHOTS:10/06/2006)T‰GwЦ>ЦкJЦ Ц|Бд=P…ŠGGraphical Symbols for Use on Equipment - Part 1: Overview and Application-Third Edition (DATABASE SNAPSHOTS:10/06/2006)TŠGwЦ@ЦмJЦ Ц|Бд=P…‹GGraphical Symbols for Use on Equipment - Part 1: Overview and Application-Third Edition (DATABASE SNAPSHOTS:10/06/2006)T‹GwЦBЦнJЦ Ц|Бд=P…ŒGGraphical Symbols for Use on Equipment - Part 1: Overview and Application-Third Edition (DATABASE SNAPSHOTS:10/06/2006)TŒGwЦDЦоJЦ Ц|Бд=PkGEnvironmental Management - Life Cycle Assessment - Life Cycle Impact Assessment-First EditionTG]ЦFЦтJЦ Ц|Б!д=PнJЦ Ц|Бд=PŒG…ŒGGraphical Symbols for Use on Equipment - Part 1: Overview and Application-Third Edition (DATABASE SNAPSHOTS:10/06/2006)TŒGwЦDЦоJЦ Ц|Бд=PGkGEnvironmental Management - Life Cycle Assessment - Life Cycle Impact Assessment-First EditionŒ!ЭHєo–BНiфд€с З6тiСPќ‰5ТnћЇ4р‹7ОjС D № œ H Ÿ K  9 І R ђžIѕ Lг0мЦr9šFЇSД`џH˜йƒћЧtд‚@t4fŽGEnvironmental management Life cycle assessment Principles and framework-Second EditionTŽGXЧЧцJЧ Ч|Бд=PGEnvironmental Management - Life Cycle Assessment - Goal and Scope Definition and Inventory Analysis-First EditionTGqЧЧщJЧ Ч|Бд=PkGEnvironmental Management - Life Cycle Assessment - Life Cycle Impact Assessment-First EditionTG]ЧЧыJЧ Ч|Бд=PŠ‘GRoad Vehicles - Diagnostic Systems - Keyword Protocol 2000 - Part 4: Requirements for Emission-Related Systems-First EditionT‘G|ЧЧяJЧ Ч|Б!д=Pr’GRoad Vehicles - Diagnostic Systems - Keyword Protocol 2000 - Part 3: Application Layer-First EditionT’GdЧЧёJЧ Ч|Бд=Pp“GRoad Vehicles - Diagnostic Systems - Keyword Protocol 2000 - Part 2: Data Link Layer-First EditionT“GbЧ ЧѓJЧ Ч|Бд=P_”GInformation technology - Service management - Part 1: Specification-First EditionT”GQЧ ЧїJЧ Ч|Бд=Pb•GInformation technology - Service managemenv - Part 2: Code of practice-First EditionT•GTЧЧљJЧ Ч|Бд=Pb–GVehicle-Mounted Aerial Devices-Fourth Edition; General Instruction No 1; Update No 2T–GTЧЧKЧ Ч|Бд=PY—GCanadian Highway Bridge Design Code-Ninth Edition; General Instruction No 1T—GKЧЧKЧ Ч|Б!д=PY˜GCanadian Highway Bridge Design Code-Ninth Edition; General Instruction No 1T˜GKЧЧKЧ Ч|Б!д=Pц™GElectromagnetic Compatibility - Requirements for Household Appliances, Electric Tools and Similar Apparatus - Part 2: Immunity - Product Family Standard-Edition 1.1; Edition 1:1997 Consolidated With Amendment 1: 2001T™GиЧЧ KЧ Ч|Бд=PцšGElectromagnetic Compatibility - Requiremenvs for Household Appliances, Electric Tools and Similar Apparatus - Part 2: Immunity - Product Family Standard-Edition 1.1; Edition 1:1997 Consolidated With Amendment 1: 2001TšGиЧЧ KЧ Ч|Б!д=Pц›GElectromagnetic Compatibility - Requirements for Household Appliances, Electric Tools and Similar Apparatus - Part 2: Immunity - Product Family Standard-Edition 1.1; Edition 1:1997 Consolidated With Amendment 1: 2001T›GкЧЧKЧ Ч|Б!д=PцœGElectromagnetic Compatibility - Requirements for Household Appliances, Electric Tools and Similar Apparatus - Part 2: Immunity - Product Family Standard-Edition 1.1; Edition 1:1997 Consolidated With Amendment 1: 2001TœGиЧЧKЧ Ч|Б!д=PцGElectromagnetic Compatibility - Requirements for Household Appliances, Electric Tools and Similar Apparatus - Part 2: Immunivy - Product Family Standard-Edition 1.1; Edition 1:1997 Consolidated With Amendment 1: 2001TGиЧЧKЧ Ч|Бд=PцžGElectromagnetic Compatibility - Requirements for Household Appliances, Electric Tools and Similar Apparatus - Part 2: Immunity - Product Family Standard-Edition 1.1; Edition 1:1997 Consolidated With Amendment 1: 2001TžGиЧ ЧKЧ Ч|Бд=PeŸGPoint-of.care testing (POCT) - Requirements for quality and competence (ISO 22870:2006)TŸGWЧ"ЧKЧ Ч|Бд=Po GFood safety management systems Requirements for any organization in the food chain-First EditionT GaЧ$ЧKЧ Ч|Бд=PmЁGGuide for the Measurement and Evaluation of Human Exposure to Vibration Transmitted to the HandTЁG_Ч&Ч#KЧ Ч|Бд=PaЂGEnvironmental management systems Requirements with guidance for use-Second EditionTЂGSЧ(Ч'KЧ Ч|Бд=PaЃGEnvironmental management systems Requirements with guidance for use-Second EditionTЃGSЧ*Ч)KЧ Ч|Бд=PaЄGEnvironmental management systems Requirements with guidance for use-Second EditionTЄGSЧ,Ч+KЧ Ч|Б!д=PaЅGEnvironmental management systems Requirements with guidance for use-Second EditionTЅGSЧ.Ч-KЧ Ч|Бд=PaІGEnvironmental management systems Requirements with guidance for use-Second EditionTІGSЧ0Ч1KЧ Ч|Б!д=PaЇGEnvironmental management systems Requirements with guidance for ure-Second EditionTЇGSЧ2Чъ^ ЖMљ˜DгОdЏ[њІEё<л‡&вeЂNщ•Џ[u ! ; ч  ­ Ч s 9рŒ3п})ЧsРPќŠ6ЌXэ™Ц`џG˜йfШYŸB„Р=йInformation technology - Security techniques - Information security management systems - Requirements-First EditionT=йsШШ&;Ш Ш|Бёд=P]>йLaser Safety in Health Care Facilities-Second Edition; General Instruction No 1T>йOШШ+;Ш Ш|Бёд=Pg?йEurocode 3: Design of steel structures Part 1-9: Fatigue-Supersedes DD ENV 1993-1-1:1992T?йYШШ1;Ш Ш|Бёд=Pg@йEurocode 3: Design of steel structures Part 1-9: Fatigue-Supersedes DD ENV 1993-1-1:1992T@йYШШ5;Ш Ш|Бёд=PqAйQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TAйcШШ<;Ш Ш|Бёд=PьBйFinancial Transaction Card Originated Messages - Interchange Message Specifications Second Edition; (CEN EN ISO 8583: 1995)-Second Edition; CEN EN ISO 8583 :1995; Technical Corrigendum 1: 12/15/1999; Replaced by ISO 8583-1TBйоШ Ш@;Ш Ш|Бёд=PƒCйBank Card Originated Messages - Interchange Message Specifications - Content for Financial Transactions-First EditionTCйuШ ШD;Ш Ш|Б!д=PƒDйBank Card Originated Messages - Interchange Message Specifications - Content for Financial Transactions-First EditionTDйuШШF;Ш Ш|Б!д=P…EйPiston-Operated Volumetric Apparatus - Part 1: Terminology, General Requirements and User Recommendations-First EditionTEйwШШJ;Ш Ш|Бёд=PZFйPiston-Opfrated Volumetric Apparatus - Part 2: Piston Pipettes-First EditionTFйLШШL;Ш Ш|Бёд=PGйPiston-operated volumetric apparatus Part 7: Non-gravimetric methods for the assessment of equipment performance-First EditionTGйШШN;Ш Ш|Бёд=PšHйPiston-operated volumetric instruments Determination of uncertainty for volume measurements made using the photometric mevhod-First EditionTHйŒШШP;Ш Ш|Бёд=PrIйDetermination of Uncertainty for Volume Measurements Made Using the Gravimetric Method-First EditionTIйdШШR;Ш Ш|Бёд=P…JйGraphical Symbols for Use on Equipment - Part 1: Overview and Application-Third Edition (DATABASE SNAPSHOTS:01/03/2006)TJйwШШT;Ш Ш|Б!д=P_KйInformation technology - Service management - Part 1: Specification-First EditionTKйQШШX;Ш Ш|Бёд=PLйInformation technology Security techniques Code of practice for information security management-INCITS AdoptionTLйqШШ\;Ш Ш|Бёд=PqMйQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TMйcШ Шb;Ш Ш|Б!д=PaNйPoint-of-care testing (POCT) Requirements for quality and competence-First EditionTNйSШ"Шk;Ш Ш|Б!д=PaOйPoint-of-care testing (POCT) Requirements for quality and competence-First EditionTOйSШ$Шm;Ш Ш|Б!д=PaPйPoint-of-care testing (POCT) Requirements for quality and competence-First EditionTPйSШ&Шo;Ш Ш|Б!д=PaQйPoint-of-care testing (POCT) Requirements for quality and competence-First EditionTQйSШ(Шq;Ш Ш|Б!д=PTRй1Dimensional Tolerances for Aluminum Mill ProductsSH0ВёКЉ@ј TSй8Industrial Control Equipment-Tenth Edition; Update No. 1КЉ@` TTй8Industrial Control Equipment-Tenvh Edition; Update No. 1КЉ@` UйMedical devices Quality management systems Guidance on the application of ISO 13485:2003-First Edition; Replaces ISO 14969:1999TUйШ-Ш;Ш Ш|Б!д=PfVйQuality management systems Guidelines for quality management in projects-Second EditionTVйXШ/Ш†;Ш Ш|Б!д=PбIшGreenhouse gases Part 2: Specification with guidance"at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhancements-First EditionTIшУШ1Ш;Ш Ш|Брд=PЖ[шCritшres rщgissant l’accrщditation des organismes de certification des personnes-Same as ISO/CEI 17024: 2003; Le prщsent document remplace le CAN-P-912 et le CAN-P-1412T[шЈШ3ШЌ;Ш Ш|Брд=Pv\шCombusvible Gas Detection Instruments; Environmental Products-General Instruction No 1-3; Second EditionT\шhШ5ШБ;Ш Ш|Б€д=PT]ш@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176a^шEnvironmental management systems Requirements with guidance for use-Second EditionT^шSШ8ШЛ;Ш Ш|Брд=P—_шChild-Resistant Packaging - Requirements and Testinf Procedures for Reclosable Packages-Second Edition; Technical Corrigendum: 02/01/2005T_ш‰Ш:ШУ;Ш Ш|Б€д=P‡`шOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 1: General First EditionT`шyШ<ШЧ;Ш Ш|Б€д=PЙaшOptics and photonics Preparation of drawings for optical elements and systems Part 10: Table representing dbta of optical elements and cemented assemblies-Second EditionTaшЋШ>ШЩ;Ш Ш|Б€д=PЙbшOptics and photonics Preparation of drawings for optical elements and systems Part 10: Table representing data of optical elements and cemented assemblies-Second EditionTbшЋШ@ШЫ;Ш Ш|Б€д=P”cшOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Szstems - Part 11: Non-Toleranced Data First EditionTcш†ШBШЭ;Ш Ш|Б€д=P’dшOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 12: Aspheric Surfaces-First EditionTdш„ШDШЯ;Ш Ш|Б€д=Peш eшOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 14: Wavefront Deformatjon Tolerance-First EditionШ Ш|Б€д=Pdш’dшOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 12: Aspheric Surfaces-First EditionTdш„ШDШЯ;Ш Ш|Б€д=PтД†X*ќЮ rDшКŒ^0дІxJюР’d6к Ќ ~ P " z†2žJ‘=„0ЉUОj Еaы—сМhЎЫw#ЯnЙeАOћ Š 6 З c  А + з e  w # –Bш”Л8фa !Э\ЁMц’5с`џF˜йW+ЩZщАTeш’ШFб;Щ Щ|Б€д=P—fшOptics and photonics Preparation of drawings for optical elements and systems Part 17: Laser irradiation damage threshold-First editionTfш‰ЩЩд;Щ Щ|Б€д=P­gшOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 2: Material Imperfections - Stress Birefringence First EditionTgшŸЩЩж;Щ Щ|Б€д=PЏhшOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 3: Material Imperfections - Bubbles and Inclusions First EditionThшЁЩЩи;Щ Щ|Б€д=PБiшOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 4: Material Imperfections - Inhomogeneity and Striae-First EditionTiшЃЩЩл;Щ Щ|Б€д=PБjшOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 4: Material Imperfections - Inhomogeneity and Striae-First EditionTjшЃЩ Щн;Щ Щ|Б€д=PЌkшOptics and Optical Instruments - Preparation of Drawings for Optical!Elements and Systems - Part 5: Surface Form Tolerances-First Edition; Corrigendum 1: 1996TkшžЩ Щп;Щ Щ|Б€д=PЌlшOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 5: Surface Form Tolerances-First Edition; Corrigendum 1: 1996TlшžЩ Щр;Щ Щ|Б€д=PЗmшOptics and Optical Instruments - Preparation of Drawings for Optical!Elements and Systems - Part 6: Centring Tolerances-First Edition; Technical Corrigendum 1:04/01/1999TmшЉЩЩт;Щ Щ|Б€д=PŸnшOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 7: Surface Imperfection Tolerances First EditionTnш‘ЩЩф;Щ Щ|Б€д=PoшOptics and Optical Instruments - Preparation of Drawings for Optical Emements and Systems - Part 8: Surface Texture-First EditionToшЩЩц;Щ Щ|Б€д=PpшOptics and Optical Instruments - Preparation of Drawings for Optical Elements and Systems - Part 9: Surface Treatment and Coating First EditionTpшЩЩш;Щ Щ|Б€д=PjqшOptics and Optical Instruments - Optical Coatings - Part 2: Optical Properties First EditionTqш\ЩЩъ;Щ Щ|Б€д=PprшOptics and Optical Instruments - Optical Coatings - Part 3: Environmental Durability First EditionTrшbЩЩь;Щ Щ|Б€д=PlsшOptics and optical instruments Optical coatings Part 4: Specific test methods-Second EditionTsш^ЩЩю;Щ Щ|Б€д=PctшOptics and Optical Instruments - Optical Coatingq - Part 1: Definitions First EditionTtшUЩЩ№;Щ Щ|Брд=PcuшOptics and Optical Instruments - Optical Coatings - Part 1: Definitions First EditionTuшUЩЩі;Щ Щ|Б€д=Pl‡шGeneral requirements for the competence of testing and calibration laboratories-Second editionT‡ш^Щ!Щ<Щ Щ|Брд=PaˆшEnuironmental management systems Requirements with guidance for use-Second EditionTˆшSЩ#Щ<Щ Щ|Брд=Pa‰шEnvironmental management systems Requirements with guidance for use-Second EditionT‰шSЩ%Щ<Щ Щ|Брд=PyŠшGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TŠшkЩ'Щ%<Щ Щ|Брд=PT‹ш@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176yŒшGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TŒшkЩ*Щ+<Щ Щ|Брд=PyшGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005yщїGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTINE AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TщїkЩ-Щc<Щ Щ|БVд=PОъїGeneral Requirements for Bodies Operating Assessment and Certification/Registration of Quality Systems-First Edition; SAA/SNZ HB18.62: 1996; Cancels and Replaces Guide 48; 1986TъїАЩ/Щg<Щ Щ|Бtд=PXыїConformity assessment Fundamentals of product certification-First EditionTыїJЩ1Щi<Щ Щ|Бtд=P}ьїDesign Quality Assurance for Nuclear Power Plants-Second Edition; General Instruction No 1; Replaced by N286-05TьїoЩ3Щm<Щ Щ|БVд=PeэїISO 9000: ISO STANDARDS COLLECTION ON CD-ROM - QUALITY MANAGEMENT-SEE ALSO ISO 14000 CDTэїWЩ5Щu<Щ Щ|Бtд=PTюїQuality Management Systems -!Fundamentals and Vocabulary-Third EditionTюїFЩ7Щw<Щ Щ|Бtд=PЭяїAmerican National Standard for Methods of Measurement of Radio-Noise Emissions from Low-Voltage Electrical and Electronic Equipment in the Range of 9 kHz to 40 GHz-Revision of ANSI C63.4-2001TяїПЩ9Щ{<Щ Щ|БVд=PŒ№їDesign and installation of non-potable water systems/ Maintenance and field testing!of non-potable water systems-First EditionT№ї~Щ;Щ<Щ Щ|Бtд=PgёїHealth informatics Electronic health record Definition, scope and context-First EditionTёїYЩ=Щ…<Щ Щ|Бtд=P|ђїHealth informatics Requirements for an electronic health record architecture-First Edition; ISO/TS 18308:2004TђїnЩ?Щ‡<Щ Щ|Бtд=PŒѓїDesign and installation of non-potable water systems/ Maintenance and field testing of non-potable water systems-First EditionTѓї~ЩAЩ‹<Щ Щ|БVд=PєїEXIGENCES GЩNЩRALES CONCERNANT LA COMPЩTENCE DES LABORATOIRES D'ЩTALONNAGES ET D'ESSAIS-Same as ISO/CEI 17025: 2005TєїsЩCЩ’<Щ Щ|Бtд=Pѕї_ѕїEPDM RUBBER, EXTERIOR - COLOR PIGMENTED ***TO BE USED WITH FORD WSS-M99P1111-A***eld testing of non-potable water systems-First EditionTѓї~ЩAЩ‹<Щ Щ|БVд=PєїєїEXIGENCES GЩNЩRALES CONCERNANT LA COMPЩTENCE DES LABORATOIRES D'ЩTALONNAGES ET D'ESSAIS-Same as ISO/CEI 17025: 2005xmРFј@ШFˆ@ШF @ШFpМСF€МСF€§пF№лћFЬjщ• Е9х~*žJ})еШKїŸK9РGѓz&вYЄPя›/лx$С m  ­ = щ  + Ž : Ћ W Иd­Y­Y­YЈTЃO LŸKД`џN˜йJ(Ъ[—‚TшkЩ,/<Ъ Ъ|Бщд=PlŽшGeneral requirements for the competence of testing and calibration laboratories-Second editionTŽш^ЪЪ4<Ъ Ъ|Бщд=PlшGeneral requirements for the competence of testing and calibration laboratories-Second editionTш^ЪЪ6<Ъ Ъ|Бщд=PlшGeneral requirements for the competence of testing and calibration laboratories-Second editionTш^ЪЪ:<Ъ Ъ|Б№д=Pl‘шGeneral requirements for the competence of testing and calibration laboratories-Second editionT‘ш^ЪЪ@<Ъ Ъ|Бд=Pl’шGeneral requirements for the competence of testing and calibrbtion laboratories-Second editionT’ш^Ъ ЪB<Ъ Ъ|Бд=Pl“шGeneral requirements for the competence of testing and calibration laboratories-Second editionT“ш^Ъ ЪD<Ъ Ъ|Бсд=Pl”шGeneral requirements for the competence of testing and calibration laboratories-Second editionT”ш^Ъ ЪF<Ъ Ъ|Бјд=Pl•шGeneral requirements for the competence of testing and calibration laboratories-Second editionT•ш^ЪЪH<Ъ Ъ|Бјд=Pl–шGeneral requirements for the competence of testing and calibration laboratories-Second editionT–ш^ЪЪJ<Ъ Ъ|Бјд=Pl—шGeneral requirements for the competence of testing and calibration laboratories-Second editionT—ш^ЪЪK<Ъ Ъ|Бјд=Pl˜шGeneral requirements for the competence of testing and calibration laboratories-Second editionT˜ш^ЪЪM<Ъ Ъ|Бјд=Py™шGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005T™шkЪЪQ<Ъ Ъ|Бсд=PlšшGeneral requirements for the competence of testing and calibration laboratories-Second editionTšш^ЪЪU<Ъ Ъ|Бјд=Pl›шGeneral requirements for the competence of testing and calibration laboratories-Second editionT›ш^ЪЪZ<Ъ Ъ|Б№д=PTѕїQЩEЪ–<Ъ Ъ|БVд=P”іїNAS Certification & Qualification of Nondestructive Test Personnel-REV 2; Includes corrected"Sheet 13 with (*) notation under Table IVTії†ЪЪ›<Ъ Ъ|Бtд=PyїїGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TїїkЪ ЪŸ<Ъ Ъ|БVд=PlјїGeneral requirements for the competence of testing and calibration laboratories-Second editionTјї^Ъ"ЪЃ<Ъ Ъ|БVд=P‹љїCriteria for Accreditation of Personnel Certification Bodies-Same as ISO/IEC 17024: 2003; Supersedes CAN-P-912 and CAN-P-1412Tљї}Ъ$ЪЇ<Ъ Ъ|Бtд=PRњїInformation technology Software asset management Part 1: ProcessesTњїDЪ&ЪЋ<Ъ Ъ|БVд=PTћїFence ConstructionV—G0@јC h4_DX&_DtВV4_D,ГV‡™GаHјCTќїFence ConstructionV—G0@јC h4_DX&_DtВV4_D,ГV‡™GаHјCT§ї Installation of Chain Link FencelКtHmEDиcD0ВtКЉ@ИTўї Installation of Chain Link FencelКtHmEDиcD0ВtКЉ@ИTџї Installation of Chain Link FencelКtHmEDиcD0ВtКЉ@ИWјFences - Part 1: Specification for Chain Link Fences-AMD 10857 July 2000;TјIЪ-ЪИ<Ъ Ъ|БVд=PTј3Fabric for Chbin Link Fence-Corrigendum: March 1996Tј$Steel Framework for Chain Link Fencedum: March 1996TјGates for Chain Link FenceLink Fencedum: March 1996ŠјCigarettes and Filter Rods - Determination of Nominal Diameter - Method Using a Laser Beam Measuring Apparatus-Third EditionTј|Ъ2ЪХ<Ъ Ъ|Бtд=PlјOccupational health and safety management systems Specifjcation-AMD 14223: December 13, 2002;Tј^Ъ4ЪЪ<Ъ Ъ|Бtд=PŽјOccupational health and safety management systems Guidelines for the implementation of OHSAS 18001-AMD 14224: December 13, 2002Tј€Ъ6ЪЬ<Ъ Ъ|Бtд=PTј@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176Tј@ISO 9001 For Small Business - What To Do - Advice From ISO/TC276ŒјRoad vehicles Diagnostics on Controller Area Networks (CAN) Part 4: Requirements for emissions-related systems-First EditionTј~Ъ:Ъё<Ъ Ъ|БVд=P\јTobacco - Determination of Water Content - Karl Fischer Method-Second Edition;TјNЪ<Ъѕ<Ъ Ъ|Бtд=PФјMaterial Used as Cigarette Papers, Filter Plug Wrap and Filter Joining Paper, Including Materians having an Oriented Permeable Zone - Determination of Air Permeability-Second EditionTјЖЪ>Ъї<Ъ Ъ|Бtд=PmјMethods of Measurement of Compatibility between Wireless Communication Devices and Hearing AidsTј_Ъ@Ъћ<Ъ Ъ|Бtд=PcјInformation and Documentation - Records Management - Part 2: Guidelines-First EditionTјUЪBЪџ>Ъ Ъ|Бtд=PeјInformation and documentation - Records management - Part 1: General (ISO 15489-1:2001)TјWЪDЪ=Ъ Ъ|Бtд=PT јSpecification for AudiometershдšFXЦšFtВtдšF,Гt‡™Gа(_DT!ј*Electronic Records as Documentary Evidence`ВKF0ВtКЉ@` S"јStandard Test Method for Peel or Stripping Strength of Adhesive BondsT"јEЪHЪ =Ъ Ъ|Бtд=PА#јRoad vehicles Communication between vehicle and external equipment for emissions-related diagnostics Part 5: Emissions-related diagnostic services-First EditionT#јЂЪJЪ=Ъ Ъ|Бtд=P$ј˜$јElectricity metering equipment (a.c.) Particular requirements Part 21: Static meters for active energy (classes 1 and 2)-First EditionT$јŠЪLЪ=Ъ Ъ|БVд=Pent for emissions-related diagnostics Part 5: Emissions-related diagnostic services-First EditionT#јЂЪJЪ=Ъ Ъ|Бtд=PMDрLMD`оŸE№;4GИ ,Gp zCPMDOMD№zC0MMDeaG90-1€?19) 6138€?€?)0д<к*жƒ/л‡"ЮkЊV’>тŽЎZx$Иdк†2оŠ3п‹7у;щ• Ж J і } ) • A э  - С m є 4рt Д`є 4рt Д`є 4рt Д`џH˜й;CЫ\ЉХ0  %јElectricity metering equipment (a.c.) Particular requirements Part 22: Static meters for active energy (classes 0,2 S and 0,5 S)-First EditionT%ј’ЫЫ=Ы Ы|БVд=Pš&јElectricity metering equipment (a.c.) Particular requirements Part 23: Static meters for reactive energy (classes 2 and 3)-First EditionT&јŒЫЫ=Ы Ы|БVд=PИ'јAlternating Current Static Watt-Hour Meters for Active Energy (Classes 1 and 2)-Edition 2:1 1996 Consolidated with Amendment 1:2000; replaced by IEC 62052-11 and 62053-21T'јЊЫЫ=Ы Ы|БVд=P(јAlternating Current Static Watt-Hour Meters for Active Energy (Classes 0,2 S and 0,5 S) Second Edition; (CENELEC EN 60687:1992)T(јЫЫ=Ы Ы|БVд=P„)јAlternating Current Static Var-Hour Meters for Reactive Energy (Classes 2 and 3) First Edition-CENELEC EN 61 268: 1996T)јvЫЫ =Ы Ы|Бtд=Px*јCapability of Detection - Part 1: Terms and Definitions-First Edition; Technical Corrigendum 1: 11/15/2003T*јjЫ Ы%=Ы Ы|Бtд=P†+јCapability of detection Part 6: Methodology for comparing the minimum detectable value with a given value-First EditionT+јxЫ Ы'=Ы Ы|Бtд=PЋ,јInformation Technology - Fibre Distributed Data Interface (FDDI) - Token Ring Twisted Pair Physical Layer Medium Dependent (TP-PMD)-Replaces ANSI X3.263-1995T,јЫЫ-=Ы Ы|Бtд=P}-јMedical devices - Quality mangement systems - Guidance on the applicavion of ISO 13485:2003, (November 8, 1999)T-јoЫЫ2=Ы Ы|БVд=Pš.јSafety Standard for Maintenance and Inspection of Overhead Cranes, Gantry Cranes, Monorails, Hoists, and Trolleys-General Instruction No 1-2T.јŒЫЫ6=Ы Ы|Бtд=PT/ј?Use of Flexible Laminated Pouches for Thermally Processed Foodss0јPaper, Board and Pulps - Measurement of Diffuse Blve Reflectance Factor (ISO Brightness)-Third EditonT0јeЫЫ@=Ы Ы|БVд=P|1јPaper, Board and Pulps - Measurement of Diffuse Reflectance Factor-Third Edition; Technical Corrigendum 1-1998T1јnЫЫB=Ы Ы|БVд=Pi2јCoating Systems for Marine Floating Navigational Aids (Buoys)-Amendment No. 1 February 1999T2ј[ЫЫG=Ы Ы|БVд=Pi3јCoating Systems for Marine Floating Navigational Aids (Buoys)-Amendment No. 1 February 1999T3ј[ЫЫK=Ы Ы|БVд=Pd4јAccess Scaffolding for Construction Purposes-Second Edition; General Instruction No. 1T4јVЫЫQ=Ы Ы|Бtд=Py5јGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2025T5јkЫЫX=Ы Ы|Бtд=Pk6јElectroacoustics – Hearing aids – Part 13: Electromagnetic compatibility (EMC)-Second EditionT6ј]Ы!ЫZ=Ы Ы|Бtд=Pk7јElectroacoustics – Hearing aids – Part 13: Electromagnetic compatibility (EMC)-Second EditionT7ј]Ы#Ы\=Ы Ы|Бtд=Pk8јElectroacoustics – Hearing aidr – Part 13: Electromagnetic compatibility (EMC)-Second EditionT8ј]Ы%Ы^=Ы Ы|Бtд=Pk9јElectroacoustics – Hearing aids – Part 13: Electromagnetic compatibility (EMC)-Second EditionT9ј]Ы'Ы_=Ы Ы|Бtд=Pq:јQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T:јcЫ)Ыe=Ы Ы|БVд=Pl;јGeneral requirements for the competence of testing and calibration laboratories-Second editionT;ј^Ы+Ыg=Ы Ы|Бtд=Pж<јGuidelines for Quality and/or Environmental Management Systems Auditing-First Edition; Replaces ISO 10011-1:1990, ISO 10011-2:1991, ISO 10011-3:1991, ISO 14010:1996, ISO 14011:1996, and ISO 14012:1996T<јШЫ-Ыi=Ы Ы|Бtд=PmNјInformation Technology - Guidelines for the Management of Software Documentation-Second EditionTNј_Ы/ЫŒ=Ы Ы|БVд=PmOјInformation Technology - Guidelines for the Management of Software Documentation-Second EditionTOј_Ы1Ы‘=Ы Ы|Бtд=PTPј Tile, CeramicВt—G0РšF h”йGX†йGtВt”йG,Гt‡™GаШšFaQјEnvironmental management syrtems Requirements with guidance for use-Second EditionTQјSЫ4Ы™=Ы Ы|Бtд=PaRјEnvironmental management systems Requirements with guidance for use-Second EditionTRјSЫ6Ы›=Ы Ы|Бtд=PaSјEnvironmental management systems Requirements with guidance for use-Second EditionTSјSЫ8ЫŸ=Ы Ы|БVд=PЯTјInformation technology Open Systems Interconnection Procedures for the operation of OSI Registration Authorities: Joint ISO and ITU-T Registration of International Organizations-First editionTTјСЫ:ЫЃ=Ы Ы|БVд=P†UјInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)TUјxЫ<ЫЇ=Ы Ы|Бtд=PlVјGeneral requirements for the competence of testing and calibration laboratories-Second editionTVј^Ы>ЫЋ=Ы Ы|БVд=PTWјLine 21 Data Service`’ F0ВtКЉ@` ‰XјVideo Systems (525/60) - Video and Accompanied Data Using the Vertical Blanking Interval - Analogue Interface-First EditionTXј{ЫAЫБ=Ы Ы|Бtд=P‰YјVideo Systems *525/60) - Video and Accompanied Data Using the Vertical Blanking Interval - Analogue Interface-First EditionTYј{ЫCЫГ=Ы Ы|Бtд=PЏZјVideo Systems (525/60) Video and Accompanied Data Using the Vertical Blanking Interval Analogue Interface Part 2: 525 Progressive Scan System-First EditionTZјЁЫEЫЕ=Ы Ы|Бtд=P[јr[јCE Code Handbook - An Explanation of Rules of the Canadian Electrical Code, Part 1-Twentieth EditionЫCЫГ=Ы Ы|Бtд=PZјЏZјVideo Systems (525/60) Video and Accompanied Data Using the Vertical Blanking Interval Analogue Interface Part 2: 525 Progressive Scan System-First EditionбoРlуВ^ђžФѕЁ@ь‹7ж‚.СmЌж‚ТQ§’>гРUˆ 4 а |  П V  † 2 П k  })ЌX­YгГ/лNњBюT`џN˜йF,Ь^dq!T[јdЫGЙ=Ь Ь|Бtд=Ph\јCapability of Detection - Part 2: Methodology in the Linear Calibration Case-First EditionT\јZЬЬУ=Ь Ь|БVд=P~]јInformation technology Security techniques Code of practice for information security management-Second EditionT]јpЬЬЧ=Ь Ь|БVд=P€^јSurgical Instruments - Non-Cutting, Articulated Instruments - General Requirements and Test Methods Second EditionT^јrЬЬЫ=Ь Ь|БVд=PЄ_јImplants for Surgery - Metal Bone Screws with Asymmetrical Thread and Spherical Under-Surface - Mechanical Requirements and Test Methods First EditionT_ј–ЬЬЭ=Ь Ь|БVд=Pm`јImplants for Surgery - Skeletal Pins and Wires - Part 3: Kirschner Skeletal Wires First EditionT`ј_Ь ЬЯ=Ь Ь|БVд=PoaјFood safety management systems Requirements for any organization in the food chain-First EditionTaјaЬ Ьг=Ь Ь|БVд=PmbјMotor Operated Food Processing Appliances (Household and Commercial)-General Instruction No 1-2 Tbј_Ь Ьи=Ь Ь|Бtд=P†cјInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)TcјxЬЬм=Ь Ь|БVд=P†dјInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)TdјxЬЬо=Ь Ь~БVд=PЈeјCleanrooms and associated controlled environments Part 7: Separative devices (clean air hoods, gloveboxes, isolators and mini-environments)-First EditionTeјšЬЬт=Ь Ь|Бtд=PyfјCleanrooms and Associated Controlled Environments - Part 1: Classification of Air Cleanliness-First EditionTfјkЬЬф=Ь Ь|Бtд=PАgјCleanrooms and Associated Controlned Environments - Part 2: Specifications for Testing and Monitoring to Prove Continued Compliance with ISO 14644-1-First EditionTgјЂЬЬц=Ь Ь|Бtд=PchјCleanrooms and associated controlled environments Part 3: Test methods-First EditionThјUЬЬш=Ь Ь|Бtд=PyiјCleanrooms and Associated Controlled Environments - Part 4: Design, Construction and Start-Up-First EdjtionTiјkЬЬъ=Ь Ь|Бtд=PajјCleanrooms and associated controlled environments Part 5: Operations-First EditionTjјSЬЬь=Ь Ь|Бtд=PTkј;INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-10th Edition` Tlј;INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-10th Edition` ymјGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TmјkЬ!Ьј=Ь Ь|Бtд=PynјGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TnјkЬ#Ьњ=Ь Ь|Бlд=P_oјInformation technology - Service management - Part 1: Specification-First EditionToјQЬ%Ь>Ь Ь|Бlд>PTpјInformation technology - Service management - Part 2: Code of practiceTpјFЬ'Ь>Ь Ь|Бlд=PQqјInformation technology - Service management - Part 1: SpecificationTqјCЬ)Ь>Ь Ь|Бlд=P_rјInformation technology - Service management - Part 1: Specification-First EditionTrјQЬ+Ь >Ь Ь|Бlд>PbsјInformation technology - Service management - Part 2: Code of practice-First EditionTsјTЬ-Ь >Ь Ь|БVд=P_tјInformation technology - Service management - Part 1: Specification-First EditionTtјQЬ/Ь>Ь Ь|БVд=PyuјGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TuјkЬ1Ь>Ь Ь|БVд=PvјEXIGENCES GЩNЩRALES CONCERNANT LA COMPЩTENCE DES LABORATOIRES D'ЩTALONNAGES ET D'ESSAIS-Same as ISO/CEI 17025: 2005TvјsЬ3Ь>Ь Ь|БVд=PwwјElectromagnetic compatibility - Product family standard for lifts, escalators and moving walks - ImmunityTwјiЬ5Ь>Ь Ь|Бtд=PaxјEnvironmental management rystems Requirements with guidance for use-Second EditionTxјSЬ7Ь">Ь Ь|Бlд=PayјEnvironmental management systems Requirements with guidance for use-Second EditionTyјSЬ9Ь$>Ь Ь|БVд=PazјEnvironmental management systems Requirements with guidance for use-Second EditionTzјSЬ;Ь&>Ь Ь|БVд=Pa{јEnvironmental management systems Requirements with guidance for use-Second EditionT{јSЬ=Ь'>Ь Ь|БVд=Pa|јEnvironmental management systems Requirements with guidance for use-Second EditionT|јSЬ?Ь)>Ь Ь|БVд=P^}јSolderability Tests for Component Leads, Terminations, Lugs, Terminals and WiresT}јPЬAЬ/>Ь Ь|Бlд=P[јRecommended Practice for Sports and Recreational Area Lighting-Errata 6/20/04TјMЬCЬ\>Ь Ь|Бtд=P[јRecommended Practice for Sports and Recreational Area Lighting-Errata 6/20/04TјMЬEЬ^>Ь Ь|Бtд=P[‘јRecommended Practice for Sports and Recreational Area Lighting-Errata 6/20/04T‘јMЬGЬ`>Ь Ь|Бtд=PT’ј<Lighting Industrial Facilities-Errata - 2001; Errata 7/20/04аˆlGT“ј:Quality Management - Guidelines for Training-First Edition”јInformation technology - Security techniques - Information security management systems - Requirements-First EditionT”јsЬKЬk>Ь Ь|БVд=P•ј•јInformation technology - Security techniques - Information security management systems - Requirements-First Editionial Facilities-Errata - 2001; Errata 7/20/04аˆlGT“ј:Quality Management - Guidelines for Training-First Edition”ј”јInformation technology - Security techniques - Information security management systems - Requirements-First EditionG0€IF/РцПG@ПIGш†LF,`W™ЋIШt ЬqТnПa ЌXїЃBю9и„ Й8фkИdЎOћЊVЎOћ‚.Е a Й X  ‹ 7 д € а |  ЏГ-йSџ’>Я{КТBюpД`џJ˜йcЭ`™bIРT•јsЬMo>Э Э|Бlд=Pt–јInformation technology - Coding of audio-visual objects - Part 10: Advanced Video Coding-Third EditionT–јfЭЭt>Э Э|Бlд=P—јInformation technology - Security techniques - Information security management systems - Requirements-First EditionT—јsЭЭx>Э Э|Бtд=P˜јPhotography Electronic still picture imaging Picture transfer protocol (PTP) for digital still photography devices-First EditionT˜ј‚ЭЭ|>Э Э|Бlд=P™јInformation technology - Security techniques - Information security management systems - Requirements-First EditionT™јsЭЭ€>Э Э|БVд=PšјInformation technology - Security techniques - Information security management systems - Requirements-First EditionTšјsЭ Э‚>Э Э|Бlд=P›јInformation technology - Security techniques - Information security management systems - Requirements-First EditionT›јsЭ Э†>Э Э|Бtд=PqœјQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TœјcЭ ЭŒ>Э Э|Бtд=PTј<Lighting Industrial Facilities-Errata - 2001; Errata 7/20/04` XžјSafety of Machinery - Emergency Stop - Principles for Design First EditionTžјJЭЭ•>Э Э|БVд=P~ŸјInformation technology Security techniques Code of practice for information security management-Second EditionTŸјpЭЭ™>Э Э|Бtд=PTуј6Division II Construction - Prestressing-Errata 01/2003T‡™GаhGOфјFIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderTфјAЭЭm?Э Э|БTд=PnхјMedical devices Quality management systems Requirements for regulatory purposes-Second EditionTхј`ЭЭq?Э Э|БTд=PnцјMedical devices Quality management systems Requirements for regulatory purposes-Second EditionTцј`ЭЭs?Э Э|БTд=PlчјGeneral requirements for the competence of testing and calibration laboratories-Second editionTчј^ЭЭx?Э Э|БTд=P шјCigarettes Measurement of nicotinefree dry particulate matter, nicotine, water and carbon monoxide in cigarette smoke Analysis of data from collaborative studies reporting relationships between repeatability, reproducibility and tolerances-First EditionTшјџЭЭ|?Э Э|Бdд=PlщјGeneral requirements for the competence of testing and calibration laboratories-Second editionTщј^ЭЭ€?Э Э|БTд=PuъјConformity assessment General requirements for bodies operating certificavion of persons-First EditionTъјgЭ!Э„?Э Э|БTд=PuыјConformity assessment General requirements for bodies operating certification of persons-First EditionTыјgЭ#Э†?Э Э|БTд=PuьјConformity assessment General requirements for bodies operating certification of persons-First EditionTьјgЭ%Эˆ?Э Э|БTд>PuэјConformity assessment General requirements for bodies operating certification of persons-First EditionTэјgЭ'ЭŒ?Э Э|БTд=PTюј)CONTAMINATION CONTROL REQUIREMENTS MANUALdВTЗ@иZњГT`ИBTяј)CONTAMINATION CONTROL REQUIREMENTS MANUALdВTЗ@иZњГT`ИBq№јQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T№јcЭ+Эœ?Э Э|БTд=PrёјManagement system requirements for nuclear power plants-First Edition; Supersedes N286.0 Thru N286.6TёјdЭ-ЭЂ?Э Э|БTд=PтђјReciprocating Internal Combustion Engines - Performance - Part 1: Declarations of Power, Fuel and Lubricating Oil Consumptions, and Test Methods - Additional Requirements for Engines for General Use-Fifth EditionTђјдЭ/ЭЊ?Э Э|БTд=PyѓјGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TѓјkЭ1ЭВ?Э Э|БTд=PyєјGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TєјkЭ3ЭЖ?Э Э|БTд=PšѕјAcoustics Description, measurement"and assessment of environmental noise Part 1: Basic quantities and assessment procedures-Second EditionTѕјŒЭ5ЭК?Э Э|БTд=PšіјAcoustics Description, measurement and assessment of environmental noise Part 1: Basic quantities and assessment procedures-Second EditionTіјŒЭ7ЭМ?Э Э|БTд=PšїјAcoustics Description, measurement and assessment of environmental noire Part 1: Basic quantities and assessment procedures-Second EditionTїјŒЭ9ЭО?Э Э|БTд=PmјјConstruction Quality Assurance for Nuclear Power Plants-Third Edition; General Instruction No 1Tјј_Э;ЭТ?Э Э|БTд=P`љјInformation and Documentation - Records Management - Part 1: General-First EditionTљјRЭ=ЭЦ?Э Э|БTд=PcњјInformation and Documentation - Records Management - Part 2: Guidelines-First EditionTњјUЭ?ЭШ?Э Э|БTд=P]‰Plastics - Determination of Water Content-First Edition; Replaces ISO 960: 1988T‰OЭAЭв?Э Э|Б=д=PTŠ;Plastics - Determination of Water Absorption-Second Edition` e‹Quality Management Systems - Fundamentalr and Vocabulary-Second Edition; ISO 9000: 2005T‹WЭDЭл?Э Э|Б=д=PŒDesign and installation of non-potable water systems/ Maintenance and field testing of non-potable water systems-First EditionT~ЭFЭї?Э Э|Б…д=PTž<Natural Gas and Propane Installation Code-Thirteenth EditionаˆсCŸSŸStandard for the Installation of Stationary Pvmps for Fire Protectionл?Э Э|Б=д=PŒDesign and installation of non-potable water systems/ Maintenance and field testing of non-potable water systems-First EditionT~ЭFЭї?Э Э|Б…д=P@І­G№Б­GџџџџџџџџФb‚.Щu!Фp ЙY˜DЊVМhЮz­4рўЊ8фsЫwЎ9хpЇ S ч “ † 2 Ц r  А B юŸKїy%Эy%Д`п‹ Ж5сQ§|(Д`џB˜йˆєЮ^ё†€™ Ї јEnvironmental Management - Life Cycle Assessment - Examples of Application of ISO 14041 to Goal and Scope Definition and Inventory Analysis-First EditionT ј™ЮЮŸ>Ю Ю|БTд=P†ЁјInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)TЁјxЮЮЄ>Ю Ю|БTд=P†ЂјInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)TЂјxЮЮІ>Ю Ю|БTд=P†ЃјInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)TЃјxЮЮЇ>Ю Ю|БTд=P†ЄјInformatjon technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)TЄјxЮЮЉ>Ю Ю|БTд=P†ЅјInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)TЅјxЮ ЮЊ>Ю Ю|БTд=P~ІјInformation technology Security techniques Code of practice for information securivy management-Second EditionTІјpЮ ЮЌ>Ю Ю|БTд=P}ЇјCranes - Information to Be Provided - Part 5: Overhead Travelling Cranes and Portal Bridge Cranes First EditionTЇјoЮЮБ>Ю Ю|БTд=PTЈј<Cranes - Training of Drivers - Part 1: General First Edition`ИBTЉј=Cranes - Crane Driving Manual - Part 1: General First EditionИBTЊј1Cranes - Safe Use - Part 1: General-First EditionЗ@иZњГT`ИBЋјMedical devices Quality management systems Requirements for regulatory purposes-Second Edition; ISO 13485: 1996TЋјqЮЮТ>Ю Ю|БTд=P~ЌјInformation technology Security techniques Code of practice for information security management-Second EditionTЌјpЮЮЦ>Ю Ю|БTд=PT­јCare Labelning of TextilesйG htwHXfwHtВTtwH,ГT‡™GаˆйG^ЎјTextile Test Methods Colourfastness to Washing Accelerated Test Launder-OmeterTЎјPЮЮЮ>Ю Ю|БTд=PpЏјTextile Test Methods Breaking Strength of Fabrics - Grab Method - Constant-Time-to-Break PrincipleTЏјbЮЮа>Ю Ю|БTд=P›АјTextiles Test Methods Appearance After Repeated Domestic Launderings -"Smoothness of Fabrics-Amendment 1: March 1994; Amendment 2: March 2001TАјЮЮв>Ю Ю|БTд=PrБјTextiles Test Methods Appearance After Repeated Domestic Launderings - Seams-Amendment 1; March 1994TБјdЮЮд>Ю Ю|БTд=PkВјTextile Test Methods Colourfastness and Dimensional Change in Domestic Laundering of TextilesTВј]Ю Юж>Ю Ю|БTд=P_ГјTextile Test Methods Tearing Strength - Single-Rip Method-Amendment No 1 May 2000TГјQЮ"Юи>Ю Ю|БTд=PгДјTextile Test Methods Quantitative Analysis of Fibre Mixtures-Supersedes 4.2 NO. 14-M88-CAN/CGSB thru 4.2 NO.14.4-M88-CAN/CGSB, 4.2 NO. 14.5-M91-CAN/CGSB, 4.2 NO. 14-6-M91-CAN/CGSB, 4.2 NO.14.7-M88-CAN/CGSB, 4.2 NO.14.8-M88-CAN/CGSB, 4.2 NO.14.9-M89-CAN/CGSB, 4.2 NO.14.11-M89-CAN/CGSB, 4.2 NO.14.12-M88-CAN/CGSB, 4.2 NO.14.13-M89-CAN/CGSB thru 4.2 NO.14.15-M89-CAN/CGSB, 4.2 NO.14.16-M88-CAN/CGSB, 4.2 NO.14.17-M89-CAN/CGSB and 4.2 NO.14.18-M91-CAN/CGSBTДјХЮ$Юк>Ю Ю|БTд=PгЕјTextile Test Methods Quantitative Analysis of Fibre Mixtures-Supersedes 4.2 NO. 14-M88-CAN/CGSB thru 4.2 NO.14.4-M88-CAN/CGSB, 4.2 NO. 14.5-M91-CAN/CGSB, 4.2 NO. 14-6-M91-CAN/CGSB, 4.2 NO.14.7-M88-CAN/CGSB, 4.2 NO.14.8-M88-CAN/CGSB, 4.2 NO.14.9-M89.CAN/CGSB, 4.2 NO.14.11-M89-CAN/CGSB, 4.2 NO.14.12-M88-CAN/CGSB, 4.2 NO.14.13-M89-CAN/CGSB thru 4.2 NO.14.15-M89-CAN/CGSB, 4.2 NO.14.16-M88-CAN/CGSB, 4.2 NO.14.17-M89-CAN/CGSB and 4.2 NO.14.18-M91-CAN/CGSBTЕјХЮ&Юм>Ю Ю|БTд=PгЖјTextile Test Methods Quantitative Analysis of Fibre Mixtures-Supersedes 4.2 NO. 14-M88-CAN/CGSB thru 4.2 NO.14.4-M88-CAN/CGSB, 4.2 NO. 14.5-M91-CAN/CGSB, 4.2 NO. 14-6-M91-CAN/CGSB, 4.2 NO.14.7-M88-CAN/CGSB, 4.2 NO.14.8-M88-CAN/CGSB, 4.2 NO.14.9-M89-CAN/CGSB, 4.2 NO.14.11-M89-CAN/CGSB, 4.2 NO.14.12-M88-CAN/CGSB, 4.2 NO.14.13-M89-CAN/CGSB thru 4.2 NO.14.15-M89-CAN/CGSB, 4.2 NO.14.16-M88-CAN/CGSB, 4.2 NO.14.17-M89-CAN/CGSB and 4.2 NO.14.18-M91-CAN/CGSBTЖјХЮ(Юо>Ю Ю|БTд=PTЗј9Textile Test Methods Colourfastness to Rubbing (Crocking)ГT`ИBiИјTextile Test Methods Flame Resistance - 45 Degree Angle Test - One Second Flame ImpingfmentTИј[Ю+Ют>Ю Ю|БTд=PZЙјTextile Test Methods Unit Mass of Fabrics-Supersedes CAN/CGSB-4.2 Method 5.ATЙјLЮ-Юф>Ю Ю|БTд=PTКј@Textile Test Methods Breaking Strength of Seams in Woven FabricstЛјGeneral criteria for the operation of various types of bodies performing inspection-ISO/IEC 17020:1998TЛјfЮ0Юъ>Ю Ю|БTд=P‚МјSoftware Engineering - Product Quality - Part 1: Quality Model-First Edition; Cancels and Replaces ISO/IEC 9126:1991TМјtЮ2Ю?Ю Ю|БTд=P‚НјSoftware Engineering - Product Quality - Part 1: Quality Model-First Edition; Cancels and Replaces ISO/IEC 9126:1991TНјtЮ4Ю?Ю Ю|БTд=P]ОјSoftware Engineering - Product Qualjty - Part 2: External Metrics-First EditionTОјOЮ6Ю?Ю Ю|БTд=P]ПјSoftware Engineering - Product Quality - Part 2: External Metrics-First EditionTПјOЮ8Ю ?Ю Ю|БTд=P]РјSoftware Engineering - Product Quality - Part 3: Internal Metrics-First EditionTРјOЮ:Ю ?Ю Ю|БTд=P]СјSoftware Engineering - Product Quality - Part 3: Internal Metrics-First EditionTСјOЮ<Ю ?Ю Ю|БTд=P]ТјSoftware Engineering - Product Quality - Part 3: Internal Metrics-First EditionTТјOЮ>Ю?Ю Ю|БTд=P]УјSoftware Engineering - Product Quality - Part 3: Internal Metrics-First EditionTУјOЮ@Ю?Ю Ю|БTд=P Ю|БTд=PТј]ТјSoftware Engineering - Product Quality - Part 3: Internal Metrics-First EditionTТјOЮ>Ю?Ю Ю|БTд=PУј]УјSoftware Engineering - Product Quality - Part 3: Internal Metrics-First EditionЇЇрZJHРEJH€FJH€ZJHшBJH Cя’>с0м+ЮzјЄ"ЮZВX›Gѓ ЬљЅв~Ы ` š F Ћ W ч “ 5 с   Л<ш”@ьoIУoщ•Л5с[`џM˜йgџЯa 1…]ФјSoftware Engineering - Product Quality - Part 3: Internal Metrics-First EditionTФјOЯЯ?Я Я|БTд=PaХјSoftware engineering Product quality Part 4: Quality in use metrics-First EditionTХјSЯЯ?Я Я|БTд=PqЦјQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TЦјcЯЯ?Я Я|БTд=PkЧјInformation Technology - Software Product Evaluation - Part 1: General Overview-First EditionTЧј]ЯЯ?Я Я|БTд=PkШјInformation Technology - Software Product Evaluation - Part 1: General Overview-First EditionTШј]ЯЯ?Я Я|БTд=PkЩјInformation Technology - Software Product Evaluation - Part 1: General Overview-First EditionTЩј]Я Я?Я Я|БTд=PkЪјInformation Technology - Software Product Evaluation - Part 1: General Overview-First EditionTЪј]Я Я!?Я Я|БTд=P‚ЫјSoftware engineering - Software product Quality Requirements and Evaluation (SQuaRE) - Guide to SQuaRE-Firqt EditionTЫјtЯЯ"?Я Я|БTд=PeЬјSoftware Engineering - Product Evaluation - Part 4: Process for Acquirers-First EditionTЬјWЯЯ3?Я Я|БTд=PeЭјSoftware Engineering - Product Evaluation - Part 4: Process for Acquirers-First EditionTЭјWЯЯ5?Я Я|БTд=PqЮјInformation Technology - Software Qroduct Evaluation - Part 5: Process for Evaluators-First EditionTЮјcЯЯ7?Я Я|БTд=PmЯјCompressed Air - Part 1: Contaminants and Purity Classes-Second Edition; Corrigendum 1 4/1/2002TЯј_ЯЯ??Я Я|Бд=PmајCompressed Air - Part 1: Contaminants and Purity Classes-Second Edition; Corrigendum 1 4/1/2002Tај_ЯЯA?Я Я|Бд=PTбјQuality Management Systems - Fundamentals and Vocabulary-Third EditionTбјFЯЯH?Я Я|БTд=PTŸEЭIЯ§?Я Я|Б…д=Pn Medical devices Quality management systems Requirements for regulatory purposes-Second EditionT `ЯЯ@Я Я|Бўд=PoЁFood safety management systemq Requirements for any organization in the food chain-ISO 22000:2005TЁaЯЯ@Я Я|Б…д=PoЂFood safety management systems Requirements for any organization in the food chain-ISO 22000:2005TЂaЯ!Я@Я Я|Б…д=PъЃInformation Technology - Telecommunications and Information Exchange between Systems - High-Level Data Link Control (HDLC) Procedures - Frame Structure-Fifth Edition; CAN/CSA-ISO/IEC 3309: 1995; Replaced by ISO/IEC 13239TЃмЯ#Я @Я Я|Б…д=PyЄGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TЄkЯ%Я@Я Я|Б=д=PQЅSpecification for Line Pipe-Forty-Third Edition; Errata: 12/20/2004TЅCЯ'Я@Я Я|Б…д=PІІSpecification for Casing and Tubing-Eighth Edition; ISO 11960:2004 Adoption; Effective Date: January 1, 2006; Errata: 3/31/2006; Errata 2: April 7, 2006TІ˜Я)Я!@Я Я|Б…д=PWЇPipeline Transportation Systems for Liquid Hydrocarbons and other LiquidsTЇIЯ+Я%@Я Я|Б…д=PЈGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558TЈѓЯ-Я1@Я Я|Бўд=PaЉEnvironmental management systems Requirements with guidance for use-Second EditionTЉSЯ/Я5@Я Я|Б…д=PaЊEnvironmental management systems Requirements with guidance for use-Second EditionTЊSЯ1Я7@Я Я|Б…д=P”ЋNAS Certification & Qualification of Nondestructive Test Personnel-REV 2; Includes corrected Sheet 13 with (*) notation under Table IVTЋ†Я3Я<@Я Я|Б=д=PxЌGeneral requirements for the competence of testing and calibration laboratories-Same as IEC/ISO 17025:2005TЌjЯ5Я@AЯ Я|Б=д=Px­General requirements for the competence of testing and calibration laboratories-Same as IEC/ISO 17025:2005T­jЯ7ЯB@Я Я|Б…д=PxЎGeneral requirements for the competence of testing and calibration laboratories-Same as IEC/ISO 17025:2005TЎjЯ9ЯD@Я Я|Бўд=PRЏInformation and documentation - Records management - Paqt 1: GeneralTЏDЯ;ЯH@Я Я|Б…д=PjАInformation and documentation - Records management - Part 1: General-(AMENDS DS/ISO 15489-1)TА\Я=ЯJ@Я Я|Б…д=PxБRecords Management Part 2: Guidelines-ISO 15489.2: 2002; Supersedes in Part AS 4390.1 Thru AS 4390.6: 1996TБjЯ?ЯL@Я Я|Бўд=PaВMedical!devices - Quality management systems - Requirements for regulatory purposesTВSЯAЯQ@Я Я|Бўд=PTФ9Standard Test Methods for Measuring Adhesion by Tape Test™Gа(F_ХInformation technology - Service management - Part 1: Specification-First EditionTХQЯDЯ~@Я Я|Бўд=PbЦInformation technology - Service management - Part 2: Code of practice-Firsu EditionTЦTЯFЯ€@Я Я|Б…д=PSЧWind turbine generator systems-***CONTAINS ALL IEC 61400 STANDARDS***TЧEЯHЯ†@Я Я|Б=д=PTШ@Plastics - Determination of Compressive Properties-Third EditionTЩ@Plastics - Determination of Compressive Properties-Third EditionTЪ@Plastics - Determination of Compressive Properties-Third EditionFЯ€@Я Я|Б…д=PЧSЧWind turbine generator systems-***CONTAINS ALL IEC 61400 STANDARDS***TЧEЯHЯ†@Я Я|Б=д=PTШ@Plastics - Determination of Compressive Properties-Third EditionрњГHЋWЏ\ІRѓŸKъ–Ъ` Кfюš"ЮVnЙeАЏ[А Жe˜DZ  — C д €  О j  Т U  ”@Я{Т] ‡3Шt ЕJі‹7ЦrН`џG˜й}ѕа~r†њрTЗfkH1Qа а|Б‹д=P2ИfISO STANDARDS COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISO 14001, 14004, 14010, 14011, 14012, DIS 14015, 14020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041, 14042, 14043, TR 14049, 14050, AND TR 14061; SEE ALSO ISO 14000 SERIES AND CDTИf$аа6Qа а|Б‹д=PqЙfQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TЙfcаа:Qа а|Б‹д=PwКfMedical Devices - Application of Risk Management to Medical Devices-First Edition; Amendment 1: 3/01/2003TКfiаа>Qа а|Б‹д=PwЛfMedical Devices - Application of Risk Mbnagement to Medical Devices-First Edition; Amendment 1: 3/01/2003TЛfiаа@Qа а|Б‹д=PwМfMedical Devices - Application of Risk Management to Medical Devices-First Edition; Amendment 1: 3/01/2003TМfiа аBQа а|Б‹д=PwНfMedical Devices - Application of Risk Management to Medical Devices-First Edition; Amendment 1: 3/01/2003TНfiа вEQа а|Б‹д=P`ОfSafety Code on Mobile Cranes-General Instruction No 1; Update No 2; Second EditionTОfRа аKQа а|БЃд=PTПfPersonal Body Armour—G0@/K h4яIX&яItВ‹4яI,Г‹‡™GаH/KTРf>Fans and Ventilators-Sixth Edition; General Instruction No 1-7`СfQuality management systems Guidelines for configuration management-Second EditionTСfRааXQа а|Б‹д=P_ТfMeasurement of gas flow by means of critical flow Venturi nozzles (ISO 9300:2005)TТfQаа\Qа а|Б‹д=PTУf@GUIDELINES FOR CORRECTIVE ACTION-Same as ISO/IEC Guide 27 : 1983aФfGeographic information Metadata-First Edition; Technical Corrigendum 1: 07/01/2006TФfSааfQа а|Б‹д=P`ХfQuality management systems Guidelines for configuration management-Second EditionTХfRааpQа а|БЃд=PИЦfBuilding construction Jointing products Classification and requirements for sealants-CORR 15975: July 31, 2006; Supersedes BS 4254:1983, BS 5215:1986, and BS 5889: 1989TЦfЊааxQа а|Б‹д=PИиfBuilding construction Jointing products Classification and requirements for sealants-CORR 15975: July 31, 2006; Supersedes BS 4254:1983, BS 5215:1986, and BS 5889: 1989TиfЊаа™Qа а|Бмд=PИйfBuilding construction Jointing products Classification and requirements for sealants-CORR 15975: July 31, 2006; Supersedes BS 4254:1983, BS 5215:1986, and BS 5889: 1989TйfЊаа›Qа а|БЃд=PИкfBuilding construction Jointing prnducts Classification and requirements for sealants-CORR 15975: July 31, 2006; Supersedes BS 4254:1983, BS 5215:1986, and BS 5889: 1989TкfЊа аQа а|БЃд=PИлfBuilding construction Jointing products Classification and requirements for sealants-CORR 15975: July 31, 2006; Supersedes BS 4254:1983, BS 5215:1986, and BS 5889: 1989TлfЊа"аŸQа а|БЃд=PИмfBuilding cnnstruction Jointing products Classification and requirements for sealants-CORR 15975: July 31, 2006; Supersedes BS 4254:1983, BS 5215:1986, and BS 5889: 1989TмfЊа$аЁQа а|БЃд=PlнfGeneral requirements for the competence of testing and calibration laboratories, (May 5, 2000)Tнf^а&аЅQа а|Б‹д=PmоfQuality Management Systems - Aerospace - Requirements-Technicanly Equivalent to AECMA prEN 9100Tоf_а(аЇQа а|Б‹д=PmпfCompressed Air - Part 1: Contaminants and Purity Classes-Second Edition; Corrigendum 1 4/1/2002Tпf_а*аЋQа а|БЃд=P•рfConformity assessmentGeneral requirements for accreditation bodies accrediting conformity assessment bodies-Sames as ISO/IEC 17011:2004Tрf‡а,аЏQа а|БЃд=P•сfConformity assessmentGeneral requirements for accreditation bodies accrediting conformity assessment bodies-Sames as ISO/IEC 17011:2004Tсf‡а.аВQа а|БЃд=PmтfCompressed Air - Part 1: Contaminants and Purity Classes-Second Edition; Corrigendum 1 4/1/2002Tтf_а0аЖQа а|Б‹д=PvуfConformity Assessment - General Requirements for Bodies Operating Certification of Persons-First EditionTуfhа2аКQа а|Б‹д=PgфfStandard Practice for Atmospheric Environmental Exposure Testing of Nonmetallic MaterialsTфfYа4аТQа а|Бмд=PTхf@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176`цfInformation and Documentation - Records Management - Part 1: General-First EditinnTцfRа7аЯQа а|Б‹д=PŽчfMeasurement of fluid flow - Procedures for the evaluation of uncertainties-Second edition; Cancels and replaces ISO/TR 5168:1998Tчf€а9агQа а|БЃд=P€шfProgramming Languages - C-Second Edition; Technical Corrigendum 1: 09/01/2001; Technical Corrigendum 2: 11/15/2004Tшfrа;азQа в|Б‹д=PTщfAccelerated Corrosion TestяI htEOXfEOtВ‹tEO,Г‹‡™Gа(яIoъfRecyclability/Recoverability Guidelines-Revision D; Replaces EDS-M-0103, GM502M, and TKLE-97-0097Tъfaа>арQа а|Бмд=PTыf;Glossary of Materials Management Terms-Supersedes 116-GP-1ap hьfDetermination of the Airtightness of Building Envelopes by the Fan Depressurization MethodTьfZаAашQа а|БЃд=PhэfDetermination of the Airtightness of Building Envelopes by the Fan Depressurization MethodTэfZаCаыQа а|БЃд=PГюfDetermination of the Overall Envelope Airtightness of Buildings by the Fan Pressurization Method Using the Building's Air Handling Systems-Amendment No. 1 April 1999TюfЅаEаюQа а|Бмд=Pmination"of the Airtightness of Building Envelopes by the Fan Depressurization MethodTэfZаCаыQа а|БЃд=PюfГюfDetermination of the Overall Envelope Airtightness of Buildings by the Fan Pressurization Method Using the Building's Air Handling Systems-Amendment No. 1 April 1999.com0€?Ёюš2оv"Ю_ З7уUЁMљ’>ШtГЪ5сt Г_ѓŸч“л‡Я { У o З c Ћ W ї Ѓ B юš;ч‡3п‹+з` •AЪvџЋ:цД`џF˜й‰љбWB8Щ OяfLiquid Flow Measurement in Open Channels - Vocabulary and SymbolsTяfAббђQб б|БЃд=P]№fLiquid Flow Measurement in Open Channels - Velocity-Area Methods (ISO 748:1979)T№fOббїQб б|БЃд=PiёfLiquid Flow Measurement in Open Channels - Establishment and Operation of a Gauging StationTёf[ббћQб б|Б‹д=P­ђfLiquid Flow Measurement in Open Channels - Velocity-Area Methods - Collection and Processing of Data for Determination of Errors in Measurement (ISO 1088:1985)TђfŸббџQб б|Бмд=P€ѓfLiquid Flow Measurement in Open Channels - Part 2: Determination of the Stage-Discharge Relation (ISO 1100-2:1982)TѓfrббRб б|Бмд=PlєfGuidelines for Implementing ISO 9000 Quality Management Systems in Public Sector OrganizationsTєf^б бRб б|БЃд=PgѕfTextiles - Stitch Types - Classification and Terminology Second Edition; (PNS 1216: 1994)TѕfYб б Rб б|БЃд=P‘іfQuality Assurance Standards - Guidelines for the"Application of ANSI/ISO/ASQC Q9001 or Q9002 to Education and Training InstitutionsTіfƒббRб б|Б‹д=P‘їfGeneral requirements for the competence of testing and calibration laboratories-Second edition; Technical Corrigendum 1: 08/15/2006TїfƒббRб б|Бмд=PјfEXIGENCES GЩNЩRALES CONCERNANT LA COMPЩTENCE DES LABORATOIRES D'ЩTALONNAGES ET D'ESSAIS-Same as ISO/CEJ 17025: 2005TјfsббRб б|Б‹д=PSљfTextiles - Seam Types - Classification and Terminology Second EditionTљfEббRб б|Бмд=PRњfCertification of Companies for Fusion Welding of Steel-Sixth EditionTњfDбб Rб б|БЃд=PXћfWelded Steel Construction (Metal Arc Welding)-Eighth Edition; Update"No. 1TћfJбб"Rб б|Б‹д=PƒќfGraphic technology Variable printing data exchange Part 1: Using PPML 2.1 and PDF 1.4 (PPML/VDX-2005)-First EditionTќfuбб&Rб б|БЃд=Pu§fGraphic technology Variable printing data exchange Part 1: Using PPML 2.1 and PDF 1.4 (PPML/VDX-2005)T§fgбб(Rб б|Бмд=PŒўfRoad vehicles Diagnostics on Controller Area Networks (CAN) Part 4: Requirements for emissions-related systems-First EditionTўf~бб,Rб б|БЃд=PŒџfRoad vehicles Diagnostics on Controller Area Networks (CAN) Part 4: Requirements for emissions-related systems-First EditionTџf~б б.Rб б|БЃд=PŒgRoad vehicles Diagnostics on Controller Area Networks (BAN) Part 4: Requirements for emissions-related systems-First EditionTg~б"б0Rб б|БЃд=PŒgRoad vehicles Diagnostics on Controller Area Networks (CAN) Part 4: Requirements for emissions-related systems-First EditionTg~б$б2Rб б|БЃд=PŒgRoad vehicles Diagnostics on Controller Area Networks (CAN) Part 4: Requirements for emissions-related systems-First EfitionTg~б&б3Rб б|Бмд=PgUL Standard for Safety Industrial Control Equipment-Seventeenth Edition; Reprint with Revisions Through and Including 7/11/2005Tgб(б7Rб б|Бмд=P€gElectrical Characteristics of Low Voltage Differential Signaling (LVDS) Interface Circuits-Revision of TIA/EIA-644Tgrб*бgMedical Devices - Application of Risk Management to Medical Devices-CORR 14652; August 19, 2003T>g_в+вьQв в|БЃд=Px?gLignes directrices relatives р la sщlection, р l entretien et р l utilisation des chaussures de protectionT?gjв-вёRв в|Б‹д=Ph@gGuide De Familiarisation au Systeme Metrique-Sixieme Edition; Fiche No 1; Mise A Jour No 2T@gZв/в§Rв в|Бмд=PXAgMetric Practice Guide-Sixth Edition; General Instruction No 1; Update Nm 2TAgJв1вџRв в|Бмд=PmBgQuality management systems Guidelines for the application of ISO 9001:2000 in local governmentTBg_в3вSв в|Б‹д=PaCgEnvironmental management systems Requirements with guidance for use-Second EditionTCgSв5вSв в|БЃд=PlDgOccupational health and safety management systems Specification-AMD 14223: December 13, 2002;TDg^в7в Sв в|БЃд=PEgLubricants, industrial oils and related products (class L) Family T (Turbines) Specification for lubricating oils for turbines-Second EditionTEgв9в Sв в|БЃд=PTFg?Cranes; steel structures; principles of design and constructionTGg3Cranes; steel structures; uerification and analysesGа^SP4В‹КЉ@THg/REQUIREMENTS FOR NONDESTRUCTIVE TESTING METHODSQ,Г‹‡™Gа()JTщt@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176ШћtAeronautical Telecommunications Volume IV Surveillance Radar and Collision Avoidance Systems-Third Edition; Incorporates Amendments 1-81; Includes Supplement to Third Edition: 03/01/2005TћtКв?в:Sв в|БIд=PTќt7Quality Management Systems - Requirements-Third Edition‡™GаШƒCT§t7Quality Management Systems - Requirements-Third Edition‡™GаШƒCTўt7Quality Management Systems - Requirements-Third Edition‡™GаШƒCqџtQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TџtcвDвCSв в|БIд=PuШuAeronautical Telecommunications Volume IV Surveillance Raear and Collision Avoidance Systems-Third Edition; Incorporates Amendments 1-81; Includes Supplement to Third Edition: 03/01/2005stems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TџtcвDвCSв в|БIд=PAИA'vт?'YJUEEBAAAAAAAAAA0€?pA№?'YOZFJBAAAAAAAAAИVх‘=щ•Эy%б})Œ8ЬxУVЊVюš"Юa |(IѕўЊКfХ q Ќ ? ы — C я › G № œ H л‡3МhзƒЇSћЇOћь˜$аД`џA˜йjгTD TuКвFGSг г|БIд=PШuAeronautical Telecommunications Volume IV Surveillance Radar and Collision Avoidance Systems-Third Edition; Incorporates Amendments 1-81; Includes Supplement to Third Edition: 03/01/2005TuКггKSг г|БIд=PЈuIndustry Implementation of International Standard ISO/IEC 12207 : 1995 (ISO/IEC 12207) Standard for Information Technology - Software Life Cycle ProcessesTušггQSг г|БIд=PКuIndustry Implementation of International Standard ISO/IEC 12207 : 1995 (ISO/IEC 12207) Standard for Information Technology - Software Life Cycle Processes - Life Cycle DataTuЌггSSг г|БIд=PШuIndustry Implementation!of International Standard ISO/IEC 12207 : 1995 (ISO/IEC 12207) Standard for Information Technology - Software Life Cycle Processes - Implementation ConsiderationsTuКггUSг г|БIд=PTu<Standard for Software Reviews-IEEE Computer Society DocumentИ ЈuIndustry Implementation of International Standard ISO/IEC 12207 : 1995 (ISO/IEC 12207) Standard for Information Technology - Software Life Cycle ProcessesTušг г[Sг г|Бжд=PwuSoftware engineering Guidelines for the application of ISO 9001:2000 to computer software-First Edition;Tuiг г_Sг г|Бжд=PШuAeronautical Telecommunications Volume IV Surveillance Radar and Collision Avoidance Systems-Third Edition; Incorporates Amendments 1-81; Includes Supplement to Third Edition: 03/01/2005TuКггcSг г|БIд=P` uEssais Non Destructifs - Qualification Et Certification Du Personnel-ISO 9712:2005T uRггgSг г|БIд=P’ uPipe Threads Where Pressure-Tight Joints Are Not Made on the Threads - Part 1: Dimensions, Tolerances and Designation-Fourth EditionT u„ггlSг г|БIд=P’ uPipe Threads Where Pressure-Tight Joints Aqe Not Made on the Threads - Part 1: Dimensions, Tolerances and Designation-Fourth EditionT u„ггnSг г|Бжд=P’ uPipe Threads Where Pressure-Tight Joints Are Not Made on the Threads - Part 1: Dimensions, Tolerances and Designation-Fourth EditionT u„ггpSг г|Бжд=P’ uPipe Threads Where Pressure-Tight Joints Are Not Made on the Threads - Part 1: Dimensions, Tolerances and Designation-Fourth EditionT u„ггrSг г|Бжд=P’uPipe Threads Where Pressure-Tight Joints Are Not Made on the Threads - Part 1: Dimensions, Tolerances and Designation-Fourth EditionTu„ггtSг г|Бжд=P’uPipe Threads Where Pressure-Tight Joints Are Not Made on the Threads - Part 1: Dimensions, Tolerances and Designation-Fourth EditionTu„ггvSг г|Бжд=P’uPipe Threads Where Pressure-Tight Joints Are Not Made on the Threads - Part 1: Dimensions, Tolerances and Designation-Fourth EditionTu„ггwSг г|Бжд=P’uPipe Threads Where Pressure-Tight Joints Are Not Made on the Threads - Part 1: Dimensions, Tolerances and Designation-Fourth EditionTu„г гySг г|Бжд=P’uPipe Threads Where Pressure-Tight Joints Are Not Made on the Threads - Part 1: Dimensions, Tolerances and Designation-Fourth EditionTu„г"г{Sг г|Бжд=PЈuIndustry Implementation of International Standard ISO/IEC 12207 : 1995 (ISO/IEC 12207) Standard for Information Technology - Software Life Cycle ProcessesTušг$гSг г|БIд=PTu.Accessible and Usable Buildings and Facilities ђQH0ВжКЉ@ VuEnduit Aux Resines Epoxydiques, Riche En Zinc-Remplace 1.183-92-CAN/CGSBTuHг'г‡Sг г|БIд=P€uInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340Turг)г‹Sг г|Бжд=P€uInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340Turг+гSг г|Бжд=P€uInsert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340Turг-гSг г|Бжд=PquQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994Tucг/г—Sг г|БIд=PuMicrobiology of Food and Animal Feeding Stuffs - Preparation of Test Samples, Initial Suspension and Decimal Dilutions for Microbiological Examination - Part 1: General Rules for the Preparation of the Initial Suspension and Decimal Dilutions-First EditionTuг1г›Sг г|Бжд=PuMicrobiology of Food and Animal Feeding Stuffs - Preparation of Test Samples, Initial Suspension and Decimal Dilutions for Microbiological Examination - Part 1: General Rules for the Preparation of the Initial Suspension and Decimal Dilutions-First EditionTuг3гžSг г|Бжд=PuMicrobiology of Food and Animal Feeding Stuffs - Preparation of Test Samples, Initial Suspension and Decimal Dilutions for Microbiological Examination - Part 1: General Rules for the Preparation of the Initial Suspension and Decimal Dilutions-First EditionTuг5гЁSг г|Бжд=PbuPetroleum and Natural Gas Industries - Pipeline Transportation Systems-First EditionTuTг7гЇSг г|Бжд=P‘uGeneral requirements for the competence of testing and calibration laboratories-Second edition; Technical Corrigendum 1: 08/15/2006Tuƒг9гЋSг г|Бжд=P]uMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TuOг;гДSг г|БIд=Pd uRecommended Practices for Machinery Installation and Installation Design-First EditionT uVг=гКSг г|Бжд=Pd!uRecommended Practices for Machinery Installation and Installation Design-First EditionT!uVг?гНSг г|Бжд=PДSг г|БIд=P ud uRecommended Practices for Machinery Installation and Installation Design-First EditionT uVг=гКSг г|Бжд=P!ud!uRecommended Practices for Machinery Installation and Installation Design-First EditionІР\ЄPѓŸКXіЂ”@2оm™EХqёGѓŸїЃН+зEё _ y % “ ? ­ Y Ч s с-йНFђJіЂк†Ьxа|Д`џG˜йˆјд‚wˆР=†"uInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)T"uxддРSд д|БIд=P[#uStandard Specification for Vacuum-Treated Steel Forgings for Generator RotorsT#uMддбSд д|Бжд=P[$uStandard Specification for Vacuum-Treated Steel Forgings for Generator RotorsT$uMддеSд д|Бжд=P[%uStandard Specification for Vacuum-Treated Steel Forgings for Generator RotorsT%uMдднSд д|Бжд=P[&uStandard Specification for Vacuum-Treated Steel Forgings for Generator RotorsT&uMддсSд д|БIд=PЕ'uGreenhouse gases Part 1: Specification with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-First EditionT'uЇд дхSд д|БIд=Pq(uQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T(ucд дъSд д|БIд=PT)u7Quality Management Systems - Requiremenus-Third EditionКЉ@ˆ T*uQuality Management Systems - Fundamentals and Vocabulary-Third EditionT*uFддюSд д|БIд=PT+uQuality Management Systems - Fundamentals and Vocabulary-Third EditionT+uFдд№Sд д|БIд=P},uQuality Management Systems - Guidelines for Performance Improvements-Second Edition; Supersedes ISO 9004-1:1994T,uoддђSд д|БIд=Pa-uQuality Management Systems - Guidelines for Performance Improvements-Second EditionT-uSддєSд д|БIд=Pж.uGuidelines for Quality and/or Environmental Management Systems Auditing-First Edition; Replaces ISO 10011-1:1990, ISO 10011-2:1991, ISO 10011-3:1991, ISO 14010:1996, ISO 14011:1996, and ISO 14012:1996T.uШддіSд д|БIд=Pf/uGuidelines for Quality and/or Environmental Management Systems Auditing-Premiшre щditionT/uXддјSд д|Бжд=P’0uWater Quality - Measurement of Biochemical Parameters - Spectrometric Determination of the Chlorophyll-a Concentration First EditionT0u„ддќSд д|БIд=Pa1uEnvironmental management systems Requirements with guidamce for use-Second EditionT1uSддTд д|Бжд=Pw2uClinical Investigation of Medical Devices for Human Subjects - Part 1: General Requirements-First EditionT2uiддTд д|Бжд=P„3uClinical investigation of medical devices for human subjects - Part 2: Clinical investigation plans (ISO 14155-2:2003)T3uvд!дTд д|БIд=PЬ4uClinical Investigation of Medical Devices for Human Subjects - Part 2: Clinical Investigation Plans-First Edition; Together with the first edition of 14155-1 Cancels and Replaces 14155: 1996T4uОд#д Tд д|Бжд=Pu5uGENERAL REQUIREMENTS FOR BODIES OPERATING PRODUCT CERTIFICATION SYSTEMS-Same as ISO/IEC Guide 65 : 1996T5ugд%дTд д|Бжд=P|5uPaper and Board - Determination of Thickness and Apparent Bulk Density or Apparent Sheet Density-Third EditionT6unд'дTд д|БIд=PT7u:Paper and Board - Determination of Grammage-Second Edition@ ~8uPaper - Determination of Tearing Resistance (Elmendorf Method)-Third Edition; CEN EN 21974: 1994; PNS 316: 1989)T8upд*дTд д|БIд=P˜9uPaqer and Board - Determination of Tensile Properties - Part 2: Constant Rate of Elongation Method-Second Edition; CEN EN ISO 1924-2: 1995T9uŠд,дTд д|БIд=P_:uInformation technology - Service management - Part 1: Specification-First EditionT:uQд.дTд д|Бжд=Pb;uInformation technology - Service management - Part 2: Code of practice-First EditionT;uTд0д!Tд д|Бжд=PbuInformation technology Security techniques Information security!management systems Requirements-ISO/IEC 27001:2005T>uuд6д*Tд д|Бжд=PШPuConstruction, Modification, Qualification, Maintenance, and Selection and Use of Means of Containment for the Handling, Offering for Transport, or Transporting of Dangerous Goods by RailTPuКд8дHTд д|БIд=P}QuMeasurement management systems Requirements for measurement processes and meaquring equipment-Premiшre EditionTQuoд:дLTд д|Бвд=PRuMicrobiology of Food and Animal Feeding Stuffs - Preparation of Test Samples, Initial Suspension and Decimal Dilutions for Microbiological Examination - Part 1: General Rules for the Preparation of the Initial Suspension and Decimal Dilutions-First EditionTRuд<дPTд д|Бд=PSuMicrobiology of Food and Animal Feeding Stuffs - Preparation of Test Samples, Initial Suspension and Decimal Dilutions for Microbiological Examination - Part 1: General Rules for the Preparation of the Initial Suspension and Decimal Dilutions-First EditionTSuд>дTTд д|Бд=PqTuQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TTucд@дXTд д|Бвд=PUuEnvironmental Management Systems - General Guidelines on Principles, Systems and Supporting Techniques-Second EditionTUuuдBд\Tд д|Бкд=PaVuEnvironmental management systems Requirements with guidance for use-Second EditionTVuSдDд^Tд д|Бкд=PWuaWuEnvironmental management systems Requirements with guidance for use-Second Editionelineq on Principles, Systems and Supporting Techniques-Second EditionTUuuдBд\Tд д|Бкд=PVuaVuEnvironmental management systems Requirements with guidance for use-Second EditionTVuSдDд^Tд д|Бкд=P—5䈧Љ8фж‚t ЃO‡3А\њІD№Ž:л‡я›ЩuљЅ0мМ 8 ф m  И d в ~  Ф юš9хhРlФpџЋіЂGѓ˜Dщ•:ц`џH˜йG7еƒˆQ 2TWuSдFmTе е|Бд=PƒXuEnvironmental Management Systems - General Guidelines on Principles, Systems and Supporting Techniques-Second EditionTXuuееpTе е|Бд=PЧYuMedical Electrical Equipment - Part 1-4: General Requirements for Safety - Collateral Standard: Programmable Electrical Medical Systems-First Edition; CEI/IEC 60601-1-4: 1996 + A1: 1999TYuЙееvTе е|Бвд=PaZuEnvironmental management systems Requirements with guidance for use-Second EditionTZuSее{Tе е|Бвд=PT[u=Furniture - Tables - Determination of Stability First EditionИBq\uGeneral requirements for the competence of testing and calibration!laboratories-ISO/IEC 17025: 2005T\ucееƒTе е|Бвд=PS]uSequential sampling plans for inspection by attributes-Second EditionT]uEе е‡Tе е|Бкд=Pa^uEnvironmental management systems Requirements with guidance for use-Second EditionT^uSе еTе е|Бкд=Pq_uQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T_ucееTе е|Бкд=PO`uSafety of Machinery - Principles of Risk Assessment-First EditionT`uAее”Tе е|Бкд=PSauPaints and Varnishes - Determination of Film Thickness-Fourth EditionTauEееšTе е|Бвд=P^buSpecification for unused mineral insulating oils for transformers and switchgearTbuPееžTе е|Бд=P^cuSpecification for unused mineral insulating oils for transformers and switchgearTcuPее Tе е|Бд=P|duBuilding Materials and Products - Procedures for Determining Declared and Design Thermal Values-Second EditionTdunееІTе е|Бд=PЃeuEnergy Performance and Capacity of Household Refrigerators, Refrigerator-Freezers, and Freezers-Sixth Edition; General Instruction No 1; Update No. 2Teu•ееВTе е|Бвд=PЃfuEnergy Performance and Capacity of Household Refrigerators, Refrigerator-Freezers, and Freezers-Sixth Edition; General Instruction No 1; Update No. 2Tfu•ееДTе е|Бвд=QЃguEnergy Performance and Capacity of Household Refrigerators, Refrigerator-Freezers, and Freezers-Sixth Edition; General Instruction No 1; Update No. 2Tgu•ееЖTе е|Бкд=PЗhuGreenhouse gases Part 1: Specification with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-ISO 14064-1:2006ThuЉе еКTе е|Бве=PШiuGreenhouse gases Part 2: Specification with guidance at the project level for quantification and reporting of greenhouse gas emission reductions and removal enhancements-ISO 14064-2:2006TiuКе"еМTе е|Бвд=P”juGreenhouse gases Part 3: Specification with guidance for the validation and verification of greenhouse gas assertions-ISO 14064-3:2006Tju†е$еОTе е}Бвд=P‘kuGeneral requirements for the competence of testing and calibration laboratories-Second edition; Technical Corrigendum 1: 08/15/2006Tkuƒе&еТTе е|Бд=P~luInformation technology Security techniques Code of practice for information security management-Second EditionTlupе(еЦTе е|Бд=PTmu/Procedure for Testing Flammability of MateriamsЗ@X”гBГв`ИBSnuTelecommunications Telephone Terminal Equipment Labeling RequirementsTnuEе+евTе е|Бд=P”ouSafety of Machinery - Positioning of Protective Equipment with Respect to the Approach Speeds of Parts of the Human Body-First EditionTou†е-ежTе е|Бкд=P”puSafety of Machinery - Positioning of Protective Equipment with Respect to the Apqroach Speeds of Parts of the Human Body-First EditionTpu†е/еиTе е|Бвд=PЪ‚uConcrete Materials and Methods of Concrete Construction/ Methods of Test and Standard Practices for Concrete-Tenth Edition; Update No 1: 07/2005; Update No 2: 06/2006; Update No 3: 08/2006T‚uМе1еUе е|Бкд=PЪƒuConcrete Materials and Methods of Concrete Construction/ Methods of Test amd Standard Practices for Concrete-Tenth Edition; Update No 1: 07/2005; Update No 2: 06/2006; Update No 3: 08/2006TƒuМе3еUе е|Бд=PЖ„uCommercial Building Telecommunications Cabling Standard Part 1 - General Requirements Addendum 7 – Guidelines for Maintaining Polarity Using Array Connectors-Addendum 7T„uЈе5еUе е|Бвд=PS…uCORROSION PROTECTIVE COATINGS – HEYAVALENT CHROMIUM FREE ZINC PLATINGT…uEе7еUе е|Бвд=PS†uCORROSION PROTECTIVE COATINGS – HEXAVALENT CHROMIUM FREE ZINC PLATINGT†uEе9еUе е|Бд=PS‡uCORROSION PROTECTIVE COATINGS – HEXAVALENT CHROMIUM FREE ZINC PLATINGT‡uEе;еUе е|Бд=PSˆuCORROSION PROTECTIVE COATINGS – HEXAVALENT CHQOMIUM FREE ZINC PLATINGTˆuEе=еUе е|Бкд=PŒ‰uSpecial Requirements for Plumbing Installations in Health Care Facilities-Third Edition; General Instruction No 1; Update No 2T‰u~е?е$Uе е|Бкд=PŸŠuHandling of Waste Materials in Health Care Facilities and Veterinary Health Care Facilities-Second Edition; General Instruction No 1; Update No 2TŠu‘еAе&Uе е|Бкд=Pm‹uGuidelines for Elementary Assessments of Building Systems in Health Care Projects-First EditionT‹u_еCе(Uе е|Бкд=P_ŒuArea Measurement for Health Care Facilities-Second Edition; Update No. 1: 11/2003TŒuQеEе*Uе е|Бкд=PuwuInfection Control during Construction or Renovatimn of Health Care Facilities-First Edition; Update No. 1sments of Building Systems in Health Care Projects-First EditionT‹u_еCе(Uе е|Бкд=PŒu_ŒuArea Measurement for Health Care Facilities-Second Edition; Update No. 1: 11/2003р:ŠLР%ŠL€&ŠLР^џЋ>ъKїkФpЩv"Я{ХqЇS‰5ЁMЙeОjь˜ГЫЏ ј Є  ­ Ж  П C я‘=п‹8ф•Aа|Чt Џ[ІR‹7Д`џC˜йэжƒC‚TuiеG,Uж ж|Бд=P–ŽuSpecial Requirements for Heating, Ventilation, and Air Conditioning (HVAC) Systems in Health Care Facilities-Second Edition; Update No 1TŽuˆжж/Uж ж|Бд=PfuIllumination Systems in Health Care Facilities-Second Edition; General Instruction No. 1TuXжж1Uж ж|Бд=PŸuHandling of Waste Materials in Health Care Facilities and Veterinary Health Care Facilities-Second Edition; General Instruction No 1; Update No 2Tu‘жж3Uж ж|Бд=Pa‘uGeographic information Metadata-First Edition; Technical Corrigendum 1: 07/01/2006T‘uSжж7Uж ж|Бд=Pœ’uStatistical interpretation of data Part 6: Determination of statistical tolerance intervals-First edition; Cancels and Replaces ISO 3207:1975T’uŽж ж;Uж ж|Бд=Pж“uGuidelines for Quality and/or Environmental Management Systems Auditing-First Edition; Replaces ISO 10011-1:1990, ISO 10011-2:1991, ISO 10011-3:1991, ISO 14010:1996, ISO 14011:1996, and ISO 14012:1996T“uШж жAUж ж|Бкд=PT”u&Solderability Tests for Printed Boards˜dВвЗ@X”гBГв`ИBT•u&Solderability Tests for Printed Boards˜dВвЗ@X”гBГв`ИB^–uSolderability Tests for Component Leads, Terminations, Lugs, Terminals and WiresT–uPжжJUж ж|Бкд=PT—uRigid Printed Board ManualƒO hŸOXŸOtВŸO,Г‡™Gа(ƒOА˜uSafety of machinery – Functional safety of safety-related electrical, electronic and programmable electronic control systems-First Edition; Corrigendum 1: 07/2005T˜uЂжжXUж ж|Бкд=PА™uSafety of machinery – Functional safety of safety-related electrical, electronic and programmable electronic control systems-First Edition; Corrigendum 1: 07/2005T™uЂжжZUж ж|Бкд=P~šuInformation technology Security vechniques Code of practice for information security management-Second EditionTšupжж_Uж ж|Бд=P~›uInformation technology Security techniques Code of practice for information security management-Second EditionT›upжжaUж ж|Бд=P~œuInformation technology Security techniques Code of practice for information security management-Second EditionTœupжжcUж ж|Бд=P~uInformation technology Security techniques Code of practice for information security management-Second EditionTupжжeUж ж|Бкд=P›žuProficiency testing by interlaboratory comparisons - Part 1: Development and operation of proficiency testing schemes-ISO/IEC GUIDE 43-1:1997TžuжжiUж ж~Бд=P›ŸuProficiency testing by interlaboratory comparisons - Part 1: Development and operation of proficiency testing schemes-ISO/IEC GUIDE 43-1:1997TŸuж жkUж ж|Бвд=P› uProficiency testing by interlaboratory comparisons - Part 1: Development and operation of proficiency testing schemes-ISO/IEC GUIDE 43-1:1997T uж"жmUж ж|Бвд=PЖЁuProficiency vesting by interlaboratory comparisons - Part 2: Selection and use of proficiency testing schemes by laboratory accreditation bodies-ISO/IEC GUIDE 43-2:1997TЁuЈж$жoUж ж|Бвд=P„ЂuRotating electrical machines – Part 17: Cage induction motors when fed from converters – Application guide-Edition 4.0TЂuvж&жsUж ж|Бд=PmЃuCompressed Air - Part 1: Contaminants and Rurity Classes-Second Edition; Corrigendum 1 4/1/2002TЃu_ж(жuUж ж|Бкд=PМЄuConformity assessment - Requirements for bodies providing audit and certification of management systems (ISO/IEC 17021:2006); German and English version EN ISO/IEC 17021:2006TЄuЎж*жzUж ж|Бвд=PъЅuGuidelines for quality and/or environmental management systems auditing-ISO 19011:2002; Svpersedes AS 3911.1, NZS 10011.1, AS 3911.2,NZS 10011.2, AS 3911.3, NZS 10011.3, AS/NZS ISO 14010,AS/NZS ISO 14011 AND AS/NZS 14012TЅuмж,ж|Uж ж|Бвд=PtІuInformation technology Open Document Format for Office Applications (OpenDocument) v1.0-First EditionTІufж.ж€Uж ж|Бвд=PtЇuInformation technology Open Document Format for Office Applications (OpenDocument)"v1.0-First EditionTЇufж0ж‚Uж ж|Бвд=PsЈuOverhead and Gantry Cranes (Top Running Bridge, Single or Multiple Girder, Top Running Trolley Hoist)TЈueж2жŠUж ж|Бд=PTЉu$Dry-Type Transformers-Fourth EditionБ ˜dВкЗ@X”гBГк`ИBzЊuMedical Electrical Equipment - Part 1: General Requirements for Safety-General Instruction No 1; Update No 2TЊulж5ж”Uж ж|Бвд=P›ЋuProficiency testing by interlaboratory comparisons - Part 1: Development and operation of proficiency testing schemes-ISO/IEC GUIDE 43-1:1997TЋuж7ж›Uж ж|Бвд=PЖЌuProficiency testing by interlaboratory comparisons - Part 2: Selection and use of proficiency testing schemes by laboratory accreditation bodies-ISO/IEC GUIDE 43-2:1997TЌuЈж9жUж ж|Бвд=P­uDocument management - Electronic document file format for long-term preservation - Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionT­uж;жЁUж ж|Бвд=P”ЎuNAS Certification & Qualification of Nondestructive Test Personnel-REV 2; Includes corrected Sheet 13 with (*) notation under Table IVTЎu†ж=жЇUж ж|Бвд=P”ЏuNAS Certification & Qualification of Nondestructive Test Personnel-REV 2; Includes corrected Sheet 13 with (*) notation under Table IVTЏu†ж?жЋUж ж|Бд=PžАuProficiency Testing by Interlaboratory Comparisions - Part 1: Development and Operation of Laboratory Proficiency Testing Schemes-Second EditionTАuжAжЏUж ж|Бкд=Pstructive Test Pfrsonnel-REV 2; Includes corrected Sheet 13 with (*) notation under Table IVTЏu†ж?жЋUж ж|Бд=PАužАuProficiency Testing by Interlaboratory Comparisions - Part 1: Development and Operation of Laboratory Proficiency Testing Schemes-Second EditionркgOРХgO€ЦgO€кgOшТ™ћЇП+зHє>ъOћ-йfžJж‚˜Dˆ4Чsя›х‘іЂГ  Ф F ђ t Ђ N а | ЬxШt ТnЦ№œЌKїXžJД`џF˜й|з„Š5ЖЦ­БuProficiency Testing by Interlaboratory Comparisions - Part 2: Selection and Use of Proficiency Testing Schemes by laboratory Accreditation Bodies-First EditionTБuŸззБUз з|Бвд=PaВuEnvironmental management systems Requirements with guidance for use-Second EditionTВuSззЛUз з|Бд=P‘ФuGeneral requirements for the competence of testing and calibration laboratories-Second edition; Technical Corrigendum 1: 08/15/2006TФuƒззйUз з|Бкд=PaХuEnvironmental management systems Requirements with guidance for use-Second EditionTХuSззрUз з|Бвд=PyЦuCleanrooms and Associated Controlled Environments - Part 1: Classification of Air Cleanliness-First EditionTЦukззтUз з|Бвд=PБЧuRecreational diving services — Safety related minimum requirements for the training of recreational scuba divers — Part 1: Level 1 — Supervised diver-First EditionTЧuЃз зцUз з|Бвд=PБШuRecreational diving services — Safety related minimum requirements for the training of recreational scuba diverq — Part 2: Level 2 — Autonomous diver-First EditionTШuЃз зшUз з|Бвд=PЌЩuRecreational diving services — Safety related minimum requirements for the training of recreational scuba divers — Part 3: Level 3 — Dive leader-First EditionTЩužззъUз з|Бвд=PwЪuRecreational diving services — Requirements for recreational scuba diving service providers-First EditionTЪuiззьUз з|Бвд=P‹ЫuCriteria for Accreditation of Personnel Certification Bodies-Same as ISO/IEC 17024: 2003; Supersedes CAN-P-912 and CAN-P-1412TЫu}ззђUз з|Бд=PTЬuIce Hockey Pucks-Second Edition; General Instruction No 1; Update No 2TЬuFззїUз з|Бкд=P}ЭuAMERICAN NATIONAL STANDAQD FOR MOBILE LADDER STANDS AND MOBILE LADDER STAND PLATFORMS-Copyrighted by ALI/LADDERTЭuoззљUз з|Бкд=P}ЮuAMERICAN NATIONAL STANDARD FOR MOBILE LADDER STANDS AND MOBILE LADDER STAND PLATFORMS-Copyrighted by ALI/LADDERTЮuoззњUз з|Бкд=P}ЯuAMERICAN NATIONAL STANDARD FOR MOBILE LADDER STANDS AND MOBILE LADDER STAND PLATFORMS-Copyrighted by ALI/LADDERTЯuoззќUз з|Бкд=P}аuAMERICAN NATIONAL STANDARD FOR MOBILE LADDER STANDS AND MOBILE LADDER STAND PLATFORMS-Copyrighted by ALI/LADDERTаuoзз§Uз з|Бкд=P}бuAMERICAN NATIONAL STANDARD FOR MOBILE LADDER STANDS AND MOBILE LADDER STAND PLATFORMS-Copyrighted by ALI/LADDERTбuoззўUз з|Бкд=P~вuInfmrmation technology Security techniques Code of practice for information security management-Second EditionTвupз з Vз з|Бкд=P–гu(DRAFT) Health informatics - Security management in health using ISO/IEC 17799 (ISO/DIS 27799:2006); English version prEN ISO 27799:2006Tгuˆз"з Vз з|Бд=P‘дuGeneral requirements for the competence of testing and calibration laboqatories-Second edition; Technical Corrigendum 1: 08/15/2006Tдuƒз$зVз з|Бкд=PqеuMetallic and Oxide Coatings - Measurement of Coating Thickness - Microscopical Method-Third EditionTеucз&зVз з|Бвд=PTжu(Structural Design of Glass for BuildingsdВкЗ@X”гBГк`ИBaзuStrength design in aluminum/ Commentary on CSA S157-05, Strength design im aluminumTзuSз)з Vз з|Бкд=P`иuQuality management systems Guidelines for configuration management-Second EditionTиuRз+з$Vз з|Бвд=PfйuQuality management systems Guidelines for quality management in projects-Second EditionTйuXз-з&Vз з|Бвд=PRкuGuidelines for Quality Management System Documentation-First EditionTкuDз/з(Vз з|Бвд=P}лuQuality Management Systems - Guidelines for Performance Improvements-Second Edition; Supersedes ISO 9004-1:1994Tлuoз1з*Vз з|Бвд=PTмuQuality Management Systems - Fundamentals and Vocabulary-Third EditionTмuFз3з,Vз з|Бвд=PЃнuMedical!electrical equipment – Part 1-6: General requirements for basic safety and essential performance – Collateral Standard: Usability-Edition 2.0Tнu•з5з.Vз з|Бвд=PƒоuInformation Technology - Software Life Cycle Processes-First Edition; Amendment 1: 5/01/2002; Amendment 2: 11/01/2004Tоuuз7з0Vз з|Бвд=PwпuSoftware engineering Guidelines for the application of IQO 9001:2000 to computer software-First Edition;Tпuiз9з2Vз з|Бвд=PЋрuFunctional Safety of Electrical/Electronic/Programmable Electronic Safety-Related Systems - Part 3: Software Requirements-First Edition; Corrigendum: 04-1999Tрuз;з4Vз з|Бвд=PƒсuInformation Technology - Software Life Cycle Processes-First Edition; Amendment 1: 5/01/2002; Amendment 2: 11/01/2004Tсuuз=з7Vз з|Бвд=PwтuSoftware engineering Guidelines for the application of ISO 9001:2000 to computer software-First Edition;Tтuiз?з9Vз з|Бвд=PЋуuFunctional Safety of Electrical/Electronic/Programmable Electronic Safety-Related Systems - Part 3: Software Requirements-First Edition; Corrigendum: 04-1999TуuзAз9Vз з|Бвд=PпфuElectromagnetic compatibility (EMC) - Part 3-12: Limits C Limits for harmonic currents produced by equipment connected to public low-voltage systems with input current >16 A and <=75 A per phase-First EditionTфuбзCзHVз з|Бвд=PхuЂхuElectromagnetic compatibility (EMC) . Part 3-2: Limits . Limits for harmonic current emissions (equipment input current .16 A per phase)-Edition 3.0gnetic compatibility (EMC) - Part 3-12: Limits C Limits for harmonic currents produced by equipment connected to public low-voltage systems with input current >16 A and <=75 A per phase-First EditionTфuбзCзHVз з|Бвд=PЕPhпЕP€пЕP˜пЕP№пЕPа4рњЕPРхЕP€цЕP€њЕPd#Я$аY‚.ƒ/Иdсъ–BюqЫwН] ЈT;ЊVРlю š  Щ L ј { ' Њ V й … 1 нRў‡3‡3‚.})А\ћЇТa `џH˜й[#и&…R T0\^яI0и и|Б#д=Pl1\General requirements for the competence of testing and calibration laboratories-Second editionT1\^ии3и и|Б#д=Pl2\General requirements for the competence of testing and calibration laboratories-Second editionT2\^ии6и и|Бфд=Pl3\General requirements for the competence of testing and calibration laboratories-Second editionT3\^ии8и и|Бфд=Pl4\General requirements for the competence of testing and calibration laboratories-Second editionT4\^ии;и и|Бйд=Pl5\General requirements for the competence of testing and calibration laboratories-Second editionT5\^и и=и и|Бйд=PG\Measurement of fluid flow by means of pressure differential devices inserted in circular cross-section conduits running full Part 1: General principles and requirements-Together with Parts 2, 3 and 4 of BS EN ISO 5167:2003, supersedes BS EN ISO 5167-1:1997;TG\и иTи и|Ббд=PlH\General requirements for uhe competence of testing and calibration laboratories-Second editionTH\^и иXи и|БŒд=PTI\ Webbing, Textile, Nylon, Tubular`OI0В|КЉ@` lJ\General requirements for the competence of testing and calibration laboratories-Second editionTJ\^ииeи и|Бдд=PlK\General requirements for the competence of testing and calibration laaoratories-Second editionTK\^ииgи и|БМд=PZL\Vehicle-Mounted Elevating and Rotating Aerial Devices-Now Copyrighted by SIATL\Lииkи и|Б|д=PZM\Vehicle-Mounted Elevating and Rotating Aerial Devices-Now Copyrighted by SIATM\Lииmи и|БМд=PqN\Laboratory Glassware - Volumetric Glasswaqe - Methods for Use and Testing of Capacity First EditionTN\cииqи и|БМд=PqO\Laboratory Glassware - Volumetric Glassware - Methods for Use and Testing of Capacity First EditionTO\cииsи и|БМд=PqP\Laboratory Glassware - Volumetric Glassware - Methods for Use and Testing of Capacity First EditionTP\cииuй и|Бiд=PqQ\Laboratory Glassware - Volumetric Glassware - Methods for Use and Testing of Capacity First EditionTQ\cииwи и|Бiд=PжR\Information technology - Open Systems Interconnection - Procedures for the operation of OSI Registration Authorities: General procedures and top arcs of the ASN.1 Object Identifier tree-Second EditionTR\Ши и}и и|Б|д=PжS\Information technology - Open Systems Interconnection - Procedures for the operation of OSI Registration Authorities: General procedures and top arcs of the ASN.1 Object Identifier tree-Second EditionTS\Ши"и‚и и|Б|д=PжT\Information technology - Open Systems Interconnection - Procedures for the operation of OSI Registration Authorities: General procedures and top arcs of the ASN.1 Object Identifier tree-Second EditionTT\Ши$и„и и|Б|д=PжU\Information technology - Open Systems Interconnection - Procedures for the operation of OSI Registration Authorities: General procedures and top arcs of the ASN.1 Object Identifier tree-Second EditionTU\Ши&и†и и|Б|д=PжV\Information technology - Open Systems Interconnection - Procedures for the operation of OSI Registration Authmrities: General procedures and top arcs of the ASN.1 Object Identifier tree-Second EditionTV\Ши(и‰и и|БМд=PRW\Restricted and Reportable Substances for Parts-Engl/Japn; Revision GTW\Dи*ии и|Бiд=P€X\Insert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340TX\rи,и”и и|Бiд=PyY\Cleanrooms and Associated Controlled Environments - Part 1: Classification of Air Cleanliness-First EditionTY\kи.и˜и и|БМд=PyZ\Cleanrooms and Associated Controlled Environments - Part 1: Classification of Air Cleanliness-First EditionTZ\kи0иšи и|БМд=PА[\Cleanrooms and Associated Controlled Environmenus - Part 2: Specifications for Testing and Monitoring to Prove Continued Compliance with ISO 14644-1-First EditionT[\Ђи2иœи и|БМд=Py\\Cleanrooms and Associated Controlled Environments - Part 4: Design, Construction and Start-Up-First EditionT\\kи4иžи и|Бмд=Pa]\Cleanrooms and associated controlled environments Part 5: Operations-First EditionT]\Sи6и и и|Бмд=Pao\Environmental management systems Requirements with guidance for use-Second EditionTo\Sи8иМи и|БМд=PPp\Packaging - Pictorial Marking for Handling of Goods-Fourth EditionTp\Bи:иРи и|Бiд=PPq\Packaging - Pictorial Marking for Handling of Goods-Fourth EditionTq\Bи<иФи и|БЬд=Par\Environmental management systems Requirements with guidance for use-Second EditionTr\Sи>иЬи и|Бмд=PQs\Systems engineering System life cycle processes-ISO/IEC 15288:2002Ts\Cи@иаи и|Бмд=P~t\Information technology Security techniques Code of practice for information secuqity management-Second EditionTt\pиBиди и|БЬд=P~u\Information technology Security techniques Code of practice for information security management-Second EditionTu\pиDиии и|Бдд=Pv\~v\Information technology Security techniques Code of practice for information security management-Second EditionTv\pиFини и|Б|д=Pи и|БЬд=Pu\~u\Information technology Security techniques Code of practice for information security management-Second EditionTu\pиDиии и|Бдд=P`иP ™$ ™0`иPЯQяqŸKњІEёЁM§ЉHє“?ЦrТnѕЁ(дTЎZ„0Z0мВ м ˆ  У R ў  9 Ш t  ЦlЌXь˜Dи„t Д`є 4рt Д`џK˜йD4й'eI~w\Information technology Security techniques Code of practice for information security management-Second EditionTw\pййрй й|Бод=P~x\Information technology Security techniques Code of practice for information security management-Second EditionTx\pййуй й|Бод=P~y\Information technology Security techniques Code of practice for information security management-Second EditionTy\pййчй й|БМд=POz\FIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderTz\Aййый й|Бод=PO{\FIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderT{\Aййэй й|Бод=PO|\FIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderT|\Aй йяй й|Бiд=Pc}\Guidelines for Quality and/or Environmental Management Systems Auditing-First EditionT}\Uй йѓй й|Б|д=Pc~\Guidelines for Quality and/or Environmental Management Systems Auditing-First EditionT~\Uййѕй й|Б|д=Pc\Guidelines for Quality and/or Environmental Management Systems Auditing-First EditionT\Uййїй й|Б|д=Pі€\Guidelines for quality and/or environmental management systems auditing-First Edition; Replaces CAN/CSA-ISO 10011-1-94, CAN/CSA-ISO 10011-2-94, CAN/CSA-ISO 10011-3-94, CAN/CSA-ISO 14010-96, CAN/CSA-ISO 14011-96, CAN/CSA-ISO 14012-96T€\шййњй й|Б|д=Pі\Guidelines for quality and/or environmental management systems auditing-First Edition; Replaces CAN/CSA-ISO 10011-1-94, CAN/CSA-ISO 10011-2-94, CAN/CSA-ISO 10011-3-94, CAN/CSA-ISO 14010-96, CAN/CSA-ISO 14011-96, CAN/CSA-ISO 14012-96T\шййќй й|Б|д=P2‚\Lignes directrices pour l´audit des systèmes de management de la qualité et/ou de management environnfmental-Premiere Edition; Remplace CAN/CSA-ISO 10011-1-94, CAN/CSA-ISO 10011-2-94, CAN/CSA-ISO 10011-3-94, CAN/CSA-ISO 14010-96, CAN/CSA-ISO 14011-96, CAN/CSA-ISO 14012-96T‚\$ййўй й|Б|д=Pl”\General requirements for the competence of testing and calibration laboratories-Second editionT”\^ййй й|Бдд=PT•\:Quality Management - Guidelines for Training-First EditionT–\:Quality Management - Guidelines for Training-First EditionT—\:Quality Management - Guidelines for Training-First EditionQE4ВМT˜\:Quality Management - Guidelines for Training-First EditionQ™\Systems engineering System life cycle processes-ISO/IEC 15288:2002T™\Cйй)й й|Бод=Plš\General requirements for the competence of testing and calibravion laboratories-Second editionTš\^й й-й й|БМд=Pl›\General requirements for the competence of testing and calibration laboratories-Second editionT›\^й"й1й й|Бмд=PTœ\Dimensioning and Tolerancing h4ІIX&ІItВм4ІI,Г쇙GаHЌHP\Mathematical Definition of Dimensioning and Tolerancing PrinciplesT\Bй%к7й й|Бдд=PTž\:Quality Management - Guidelines for Training-First Edition@аTŸ\:Quality Management - Guidelines for Training-First Edition@аT \:Quality Management - Guidelines for Training-First EditionXЁ\Quality Management - Guidelines for Training-First Edition; ISO 10015:1999TЁ\Jй*йLй й|Бод=PXЂ\Quality Management - Guideliner for Training-First Edition; ISO 10015:1999TЂ\Jй,йNй й|Бiд=PQЃ\Systems engineering System life cycle processes-ISO/IEC 15288:2002TЃ\Cй.йVй й|Бдд=PqЄ\Particle size analysis Image analysis methods Part 1: Static image analysis methods-First EditionTЄ\cй0й^й й|Бод=P€Ѕ\Insert, Rcrew Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340TЅ\rй2йdй й|Бдд=P€І\Insert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions for-FSC 5340TІ\rй4йfй й|Бдд=PкЇ\Specification and qualification of welding procedures for metallic materials - Welding procedure"test - Part 1: Arc and gas welding of steels and arc welding of nickel and nickel alloys (ISO 15614-1:2004)TЇ\Ьй6йjй й|Бiд=PкЈ\Specification and qualification of welding procedures for metallic materials - Welding procedure test - Part 1: Arc and gas welding of steels and arc welding of nickel and nickel alloys (ISO 15614-1:2004)TЈ\Ьй8йmй й|Бiд=PoЉ\Stanfard Guide for Property Condition Assessments: Baseline Property Condition Assessment ProcessTЉ\aй:йsй й|Бiд=PoЊ\Standard Guide for Property Condition Assessments: Baseline Property Condition Assessment ProcessTЊ\aй<йwй й|Бiд=PЉЋ\Guide ISO 9000 Et 13485; Lignes Directrices Pour L'Application Des Normes ISO 9000 Et 13485 A L'Intention Des Fabricants De Dirpositifs Medicaux-2e EditionTЋ\›й>й|й й|Б|д=PRЌ\Cast Iron Pipe Flanges and Flanged Fittings Classes 25, 125, and 250TЌ\Dй@й€й й|Бiд=PR­\Cast Iron Pipe Flanges and Flanged Fittings Classes 25, 125, and 250T­\DйBй‚й й|Бдд=PTЎ\-Ductile-Iron and Gray-Iron Fittings for WaterTЏ\-Ductile-Iron and Gray-Iron Fittings for WaterWА\Flanged Ductile-Iron Pipe with Ductile-Iron or Gray-Iron Threaded FlangesTА\IйFйŽй й|БМд=PTБ\0Ductile-Iron Compact Fittings, for Water Serviceј)ФG0ВЬКЉ@аВ\oВ\Food safety management systems Requirements for any organization in the food chain-First EditionTВ\aйIйšй й|БМд=Puctile-Iron or Gray-Iron Threaded FlangesTА\IйFйŽй й|БМд=PTБ\0Ductile-Iron Compact Fittings, for Water Serviceј)ФG0ВЬКЉ@а`ЧP`{ЧPzff-@ж~Pk7@№?@№?šЩх*ѕС?P(Х;X6@›ќ1I‚њм?Т4A‚1@рqЛdМhТpsА\э™Пk‘=Нiщ•$а+г'г+з‡3пsГ _  К f  О j ў Њ x $ .кф-йv"ПkШy%ж‚А2о`џN˜йcк)ЭAaГ\Environmental management systems Requirements with guidance for use-Second EditionTГ\SккЁк к|БМд=PlД\General requirements for the competence of testing and calibration laboratories-Second editionTД\^ккІк к|Бдд=PlЕ\General requirements for the competence of testing and calibration laboratories-Second editionTЕ\^ккЈк к|Бдд=PTЖ\7Quality Management Systems - Requirements-Third EditionКЉ@аЫЗ\Graphical Symbols for Diagrams Part 1: General Information, General Index Cross-Reference Tables-First Edition; Replaces IEC 60617-12:1997, IEC 60617-13:1993; (DATABASE SNAPSHOT:04/01/2005)TЗ\НккАк к|Бiд=PTИ\7Quality Management Systems - Requirements-Third EditionКЉ@аŽЙ\Measurement of fluid flow - Procedures for the evaluation of uncertainties-Second edition; Cancels and replaces ISO/TR 5168:1998TЙ\€к кПк к|БМд=PXЫ\Quality management systems - Guidelines for quality plans (ISO 10005:2005)TЫ\Jк кск к|Бмд=PXЬ\Quality!management systems - Guidelines for quality plans (ISO 10005:2005)TЬ\Jккук к|Бмд=PXЭ\Quality management systems - Guidelines for quality plans (ISO 10005:2005)TЭ\Jккхк к|Бмд=PlЮ\General requirements for the competence of testing and calibration laboratories-Second editionTЮ\^ккѓк к|Бдд=PfЯ\Quality management systems Guidelines for the application of ISO 9001:2000 in educationTЯ\Xккїк к|Б|д=Pfа\Quality management systems Guidelines for the application of ISO 9001:2000 in educationTа\Xккћк к|Бод=PTб\7Quality Management Systems - Requirements-Third EditionКЉ@аcв\Software Considerations in Airborne Sysuems and Equipment Certification-Errata - 1999Tв\Uккк к|Бiд=PTг\:DESIGN ASSURANCE GUIDANCE FOR AIRBORNE ELECTRONIC HARDWAREљG8ВiTд\=Graphical symbols for use in the labelling of medical devicesTе\Terminology relating to reliability, maintainability and availability.Tе\Fккк к|БЬд=Pж\Identification Cards - Identification of Issuers - Part 2: Application and Registration Procedures-Second EditionTж\qккк к|БЩд=PPз\Requirements for Private Branch Exchange (PBX) Switching EquipmentTз\Bк!к#к к|БЩд=Plи\General requirements for the competence of testing and calibration laboratories-Second editionTи\^к#к(к к|БЩд=Plй\General requirements for the competence of testing and calibration laboratories-Second editionTй\^к%к*к к|БДд=Plк\General requirements for the competence of testing and calibration laboratories-Second editionTк\^к'к/к к|БДд=PZь\Identification Cards - Recording Technique - Part 1: Embossing-Third EditionTь\Lк)кHк к|Б”д=PZэ\Identification Cards - Recording Technique - Part 1: Embossing-Third EditionTэ\Lк+кJк к|Бсд=PZю\Identification Cards - Recording Technique - Part 1: Embossing-Third EditionTю\Lк-кKк к|Б”д=P^я\Identification cards Recording technique Part 1: Embossing-ISO/IEC 7811-1:2002Tя\Pк/кMк к|Бсд=Pp№\Identification cards - Recording technique - Part 3: Location of embossed characters on ID-1 cardsT№\bк1кOк к|Б”д=P~ё\Information technology Security techniques Code of practice for information security management-Second EditionTё\pк3кSк к|Б”д=Pgђ\Standard Practice for Repair of Damaged and Uncoated Areas of Hot-Dip Galvanized CoatingsTђ\Yк5кWк к|Бсд=Ptѓ\Road Vehicles - Diagnostic Systems - Requirements for Interchange of Digital Information First EditionTѓ\fк7к]к к|Бцд=PŸє\Road Vehicles - Diagnostic Systems - Part 2: CARB Requirements for Interchange of Digital Information-First Edition 1994; Amendment 1: 12-01-1996Tє\‘к9к_к к|Бцд=P’ѕ\Road vehicles - Diagnostic systems - Part 2: CARB requirements for interchange of digital information-Première éditionTѕ\„к;кaк к|Бцд=Pі\Road Vehicles - Diagnostic Systems - Part 3: Verification of the Communication Between Vehicle and OBD II Scan Tool-First EditionTі\к=кcк к|Бцд=Poї\Road Vehicles - Diagnostic Systems - Keyword Protocol 2000 - Part 1: Physical Layer-First EditionTї\aк?кeк к|БДд=Ppј\Road Vehicles - Diagnostic Systems - Keyword Protocol 2000 - Part 2: Data Link Layer-First EditionTј\bкAкgк к|БДд=Prљ\Road Vehicles - Diagnostic Systems - Keyword Protocol 2000 - Part 3: Application Mayer-First EditionTљ\dкCкiк к|Бсд=PŠњ\Road Vehicles - Diagnostic Systems - Keyword Protocol 2000 - Part 4: Requirements for Emission-Related Systems-First EditionTњ\|кEкkк к|Бсд=Puћ\Road vehicles Diagnostics on Controller Area Networks (CAN) Part 1: General information-Frist EditionTћ\gкGкmк к|Бсд=Pxќ\Road vehicles Diagnostics on Controller Area Networks (CAN) Part 2: Network layer services-First EditionTќ\jкIкoк к|Бсд=Pœ§\Road vehicles Diagnostics on Controller Area Networks (CAN) Part 3: Implementation of unified diagnostic services (UDS on CAN)-First EditionT§\ŽкKкqк к|Бсд=Pў\Œў\Road vehicles Diagnostics!on Controller Area Networks (CAN) Part 4: Requirements for emissions-related systems-First Editionќ\jкIкoк к|Бсд=P§\œ§\Road vehicles Diagnostics on Controller Area Networks (CAN) Part 3: Implementation of unified diagnostic services (UDS on CAN)-First Editionзuй… ЙD№f LмˆХ6тPќ] •Aк†ДD№’>ф6тˆ4ШtД H є Є P б } ) е  - Ъ v " МhЎBю–Bъ–>ъ\Дщ•AеС`џK˜йeл*КŒ$Tў\~кMsл л|Бсд=Pqџ\Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994Tџ\cллzл л|БДд=Pq]Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T]cлл|л л|Бсд=Pq]Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T]cлл~л л|Б”д=Pq]Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T]cлл€л л|Б”д=Pq]Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T]cл л‚л л|Бсд=Pl]General requirements for the competence of testing and calibration laboratories-Second editionT]^л л‡л л|Б”д=P~]Information technology Security techniques Code of practice for information security management-Second EditionT]pл л”л л|Б”д=P~]Information technology Security techniques Code of practice for information security management-Second EditionT]pлл–л л|Б”д=P”]Plastics - Determination of tensile properties - Part 1: General principles-First Edition; Corrigendum 1-1994; Amendment 1: 09-01-2005T]†ллšл л|Бцд=Pˆ]Plastics - Determination!of Tensile Properties - Part 2: Test Conditions for Moulding and Extrusion Plastics-First EditionT]zллœл л|Бсд=PT ]1Alloy and Temper Designation Systems for AluminumЗ@XєвBГЩ`HЗBl ]General requirements for the competence of testing and calibration laboratories-Second editionT ]^ллЈл л|БЩд=Px ]Biological Evaluation of Medical Devices!- Part 1: Evaluation and Testing-Second Edition; ISO 10993-1:1997T ]jллЎл л|БДд=P ]Medical devices Quality management systems Requirements for regulatory purposes-Second Edition; ISO 13485: 1996T ]qллВл л|БЩд=Pl ]General requirements for the competence of testing and calibration laboratories-Second editionT ]^ллЖл л|Бцд=Pl]General requirements for the competence of testing and calibration laboratories-Second editionT]^ллЛл л|БЩд=Pl]General requirements for the competence of testing and calibration laboratories-Second editionT]^л лНл л|Бцд=PT]=Graphical Symbols for Use in the Labelling of Medical DevicesHЗBU]Standard for Aerospace and Industrial Electrical Cable-Errata 1/17/2001T]Gл#лХл л|БЩд=PU]Standard for Aerospace and Industrial Electrical Cable-Errata 1/17/2001T]Gл%лЩл л|Бцд=Po]Food safety management systems Requirements for any organization in the food chain-First EditionT]aл'лЯл л|БДд=Po]Food safety management systems Requirements for any organization in the food chain-First EditionT]aл)лгл л|БДд=Pi]Medical laboratories Guidance on laboratory implementation of ISO 15189:2003-First EditionT][л+лнл л|Б”д=Pi]Medical laboratories Guidance on laboratory implementation of ISO 15189:2003-First EditionT][л-лсл л|БДд=Po]Food safety management systems Requirements for any organization in the food chain-First EditionT]aл/лул л|БДд=Po]Food safety management systems Requirements for any organization in the food chain-First EditionT]aл1лчл л|БЩд=Pl]General requirements for the aompetence of testing and calibration laboratories-Second editionT]^л3лыл л|Бсд=Pa]Environmental management systems Requirements with guidance for use-Second EditionT]Sл5лял л|Б”д=Pl]General requirements for the competence of testing and calibration laboratories-Second editionT]^л7лѓл л|Бсд=P~]Information technology Security techniques Code of practice for information security management-Second EditionT]pл9лњл л|Бсд=P’]SA-6/SA-6M Specification for General Requirements for Rolled Structural Steel Bars, Plates, Shapes, and Sheet Piling-ASTM A6/A6M-99bT]„л;лўл л|Б”д=Pl=]General requirements for the competence of testimg and calibration laboratories-Second editionT=]^л=л`л л|Бод=Pl>]General requirements for the competence of testing and calibration laboratories-Second editionT>]^л?лdл л|Бод=P)?]Structural Standard for Antenna Supporting Structures and Antennas-EFFECTIVE JANUARY 1, 2006; Includes County Listing 07/20/2005 after TIA-222-G standard - Please contact Globam Engineering Documents (1-800-447-3352 ext.4960) for a electronic version of the 07/20/2005 County ListingT?]лAлhл л|Бдд=P”@]Phosphoric Acid for Industrial Use - Determination of Arsenic Content - Silver Diethyldithiocarbamate Photometric Method First EditionT@]†лCлnл л|БМд=P~A]General Method for the Determination of Arsenic - Silver Diethyldithiocarbamate Photometric Method-First EditionTA]pлEлrл л|БЬд=P…B]Acceptance Conditions for Plano-Milling Machines - Testing of the Accuracy - Part 2: Gantry-Type Machines First EditionTB]wлGлxл л|БЬд=PTC]0Automotive Parts - Color Code for Wiring Harness`в–G0ВЬКЉ@` D]`D]Safety Code on Mobile Cranes-General Instruction No 1; Update Mo 2; Second EditionpлEлrл л|БЬд=PB]…B]Acceptance Conditions for Plano-Milling Machines - Testing of the Accuracy - Part 2: Gantry-Type Machines First EditionTB]wлGлxл л|БЬд=P@@№?ГQ§x$ІRОjAэ-Сmл‡ ЕIѕ”@д€НNњ‘=д€НNњЅQќ Ј T ш ” ( д h  • A Щ u Еaй…ёЫMљ9ШtЏ>ъy%Д`џB˜йs м*VмAZ]Identification Cards - Recording Technique - Part 1: Embossing-Third EditionT]Lммм м|БЬд=PЩ]Identification Cards - Recording Technique - Part 6: Magnetic Stripe - High Coercivity-Second Edition; Cancels and Replaces ISO/IEC 7811-6: 1996; ISO/IEC 7811-4: 1995; ISO/IEC 7811-5:1995T]Лммм м|БЬд=PН ]Electromagnetic compatibility - Product family standard for audio, video, and audio-visual and entertainment lighting control apparatus for professional use - Part 1: EmissionT ]Џмм м м|Бод=PН!]Electromagnetic compatibility - Product family standard for audio, video, and audio-visual and entertainment lighting control apparatus for professional use - Part 1: EmissionT"]Џмм м м|Бод=PЙ"]Electromagnetic compatibility - Product family standard for audio, video, audio-visual and entertainment lighting control apparatus for professional use - Part 2: ImmunityT"]Ћммм м|Б|д=PЙ#]Electromagnetic compatibility - Product family standard for audio, video, audio-visual and entertainment lighting control apparatus for professional usf - Part 2: ImmunityT#]Ћм мм м|Б|д=P)$]Structural Standard for Antenna Supporting Structures and Antennas-EFFECTIVE JANUARY 1, 2006; Includes County Listing 07/20/2005 after TIA-222-G standard - Please contact Global Engineering Documents (1-800-447-3352 ext.4960) for a electronic version of the 07/20/2005 County ListingT$]м мм м|БЬд=P)%]Structural Stbndard for Antenna Supporting Structures and Antennas-EFFECTIVE JANUARY 1, 2006; Includes County Listing 07/20/2005 after TIA-222-G standard - Please contact Global Engineering Documents (1-800-447-3352 ext.4960) for a electronic version of the 07/20/2005 County ListingT%]ммм м|Бiд=P)&]Structural Standard for Antenna Supporting Structures and Antennas-EFFECTIVE JANUARY 1, 2006; Includes County Listing 07/20/2005 after TIA-222-G"standard - Please contact Global Engineering Documents (1-800-447-3352 ext.4960) for a electronic version of the 07/20/2005 County ListingT&]ммм м|Бод=Pl']General requirements for the competence of testing and calibration laboratories-Second editionT']^мм!м м|Бод=Pl(]General requirements for the competence of testing and calibration laboratories-Secnnd editionT(]^мм'м м|Бод=Pa)]Environmental management systems Requirements with guidance for use-Second EditionT)]Sмм)м м|БМд=Po*]Food safety management systems Requirements for any organization in the food chain-First EditionT*]aмм7м м|Бод=Po+]Food safety management systfms Requirements for any organization in the food chain-First EditionT+]aмм=м м|Бод=PTD]RлJм„м м|БМд=P`E]Safety Code on Mobile Cranes-General Instruction No 1; Update No 2; Second EditionTE]Rмм†м м|БМд=P`F]Safety Code on Mobile Cranes-General Instruction No 1; Update No 2; Second EditinnTF]Rмм‡м м|БМд=P`G]Safety Code on Mobile Cranes-General Instruction No 1; Update No 2; Second EditionTG]Rм!м‰м м|Бод=PH]Medical devices Quality management systems Requirements for regulatory purposes-Second Edition; ISO 13485: 1996TH]qм#мм м|Бод=PI]Medical devices Qualjty management systems Requirements for regulatory purposes-Second Edition; ISO 13485: 1996TI]qм%м’м м|Б|д=PJ]Medical devices Quality management systems Requirements for regulatory purposes-Second Edition; ISO 13485: 1996TJ]qм'м”м м|Бiд=PŒK]Copper, Lead and Zinc Sulfide Concentrates - Sampling Procedures for Determination of Metal and Moisture Contenv-First EditionTK]~м)м˜м м|Бод=PL]Copper, Lead and Zinc Sulfide Concentrates - Determination of Mass Loss of Bulk Materials on Drying-First EditionTL]qм+мšм м|БЬд=PM]Copper, Lead and Zinc Sulfide Concentrates - Determination of Mass Loss of Bulk Materials on Drying-First EditionTM]qм-мœм м|БЬд=PlN]General requirements for the competence of testing and calibration laboratories-Second editionTN]^м/мŸм м|Бдд=PO]Copper, Lead and Zinc Sulfide Concentrates - Determination of Mass Loss of Bulk Materials on Drying-First EditionTO]qм1мЁм м|Бiд=PTP]Matallic MaterialsМ—G0@œD htœDXfœDtВМtœD,ГМ‡™GаHœD‰Q]Imbging Materials - Processed Photographic Films, Plates and Paper - Filing Enclosures and Storage Containers-First EditionTQ]{м4мЋм м|БЬд=P‰R]Imaging Materials - Processed Photographic Films, Plates and Paper - Filing Enclosures and Storage Containers-First EditionTR]{м6м­м м|БЬд=PŒS]Distribution Cables with Extruded Insulation for Rated Voltages from 3,6.6 (7,2) kV to 20,8/36 (42) kV-Volume II: Parts 6 to 9TS]~м8мАм м|Бмд=PŒT]Distribution Cables with Extruded Insulation for Rated Voltages from 3,6/6 (7,2) kV to 20,8/36 (42) kV-Volume II: Parts 6 to 9TT]~м:мВм м|Бмд=PŒU]Distribution Cables with Extruded Insulation for Rated Voltages from 3,6/6 (7,2) kV to 20,8/36 (42) kV-Volume II: Parts 6 to 9TU]~м<мДм м|Бмд=PŒV]Distribution Cables with Extruded Insulation for Rated Voltages from 3,6/6 (7,2) kV to 20,8/36 (42) kV-Volume II: Parts 6 to 9TV]~м>мЕм м|Бмд=PŒW]Distribution Cables with Extruded Insulation for Rated Voltages from 3,6/6 (7,2) kV to 20,8/36 (42) kV-Volume II: Parts 6 to 9TW]~м@мЗм м|Бмд=Ples with Extruded Insulation for Rated Voltages from 3,6/6 (7,2) kV to 20,8/36 (42) kV-Volume II: Parts 6 to 9TV]~м>мЕм м|Бмд=PW]ŒW]Distribution Cables with Extruded Insulation for Rated Voltages from 3,6/6 (7,2) kV to 20,8/36 (42) kV-Volume II: Parts 6 to 9`kеPЕ)еIѕi‰5ЉUЬxя›GШtД5сb‚.Џ[мˆ ЕUЁMэ™Eж ‚  П ^ ž J о Š a фgZMљ<ш+зК`џM˜йZн,­,TX]$Temperature measurement: techniques.Љ@XXP ЫC4ВоTY]$Temperature measurement: techniques.Љ@XXP ЫC4ВоTZ]$Temperature measurement: techniques.i[]Phase II Environmental Site Assessment-First Edition; General Instruction No 1; Update No 3T[][ннФн н|Бдд=PЇ\]Exigences De Rendement Des Emballages Destines Au Transport Des Marchandises Dangereuses-Remplace: 43-GP-152MP Et 43-GP-153MP; Rectificatif: Janvier 1999T\]™ннЫн н|БЬд=P€]]Acoustics - Attenuation of Sound During Propagation Outdoors - Part 2: General Method of Calculation-First EditionT]]rннЯн н|БМд=P€^]Acoustics!- Attenuation of Sound During Propagation Outdoors - Part 2: General Method of Calculation-First EditionT^]rн нбн н|БМд=Pq_]Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T_]cн нен н|БМд=P]`]Commentary on CSA Standard Z662-03, Oil and Gas Pipeline Systems-Second EditionT`]Oн нлн н|Б|д=PQa]Entrance Flooring Systems - Selection, Installation and MaintenanceTa]Cннпн н|Бод=PTZk9Rice Milling - Symbols and Equivalent Terms First Edition™GаЈ‡ET[k@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176T\k@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176s]kPersonal flotation devices Paqt 1: Lifejackets for seagoing ships Safety requirements-First EditionT]keнн?н н|Бўд=PT^k1Alloy and Temper Designation Systems for Aluminum_kDocument management - Electronic document file format for long-term preservation - Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionT_kннGн н|Бід=P`kDocument management - Electronic!document file format for long-term preservation - Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionT`kннIн н|Бід=PдakSafety of Laser Products - Part 1: Equipment Classification, Requirements and User´s Guide-Edition 1.2; Edition 1: 1993 Consolidated with Amendments 1: 1997 and 2: 2001; Corrigendum 1: 06/2002TakЦннQн н|Бід=PibkPhase II Environmentam Site Assessment-First Edition; General Instruction No 1; Update No 3Tbk[ннUн н|Бід=PickPhase II Environmental Site Assessment-First Edition; General Instruction No 1; Update No 3Tck[ннWн н|Бід=PidkPhase II Environmental Site Assessment-First Edition; General Instruction No 1; Update No 3Tdk[н!нYн н|БJд=PiekPhase II Environmental Site Assessment-First Edition; General Instruction No 1; Update No 3Tek[н#н[н н|БJд=PifkPhase II Environmental Site Assessment-First Edition; General Instruction No 1; Update No 3Tfk[н%н\н н|БJд=PigkPhase II Environmental Site Assessment-First Edition; General Instruction No 1; Update No 3Tgk[н'н]н н|БJд=PlhkGeneral requirements for the competence of testing and calibration laboratories-Second editionThk^н)нbн н|Бід=PlikGeneral requirements for the competence of testing and calibration laboratories-Second editionTik^н+нdн н|Бід=PЋщzStandard Test Method for Arrhenius Kineuic Constants for Thermally Unstable Materials Using Differential Scanning Calorimetry and the Flynn/Wall/Ozawa MethodTщzн-нpн н|Бјд=PfъzQuality management systems Guidelines for the application of ISO 9001:2000 in educationTъzXн/нtн н|Бјд=PkыzSafety of Machinery - Minimum Gaps to Avoid Crushing of Parts of the Human Body-First EditionTыz]н1нxн н|Бјд=PPьzCode d installation du gaz naturel et du propane-Treizieme EditionTьzBн3н|н н|Бд=P†эzInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)Tэzxн5н€н н|Бд=P†юzInformation technology - Security techniques - Coee of practice for information security management (ISO/IEC 17799:2005)Tюzxн7нƒн н|БVд=PTяz<Oilseeds - Determination of Content Impurities-Third Edition4ВT№z8Oilseeds - Sampling-Second Edition; CEN EN ISO 542: 1995tion4ВUёzOilseeds - Reduction of Laboratory Sample to Test Sample-Second EditionTёzGн;н‘н н|Бд=PˆђzPulses!- Determination of Impurities, Size, Foreign Odours, Insects, and Species and Variety - Test Methods-Second EditionTђzzн=н“н н|Бд=PšѓzSafety Standard for Maintenance and Inspection of Overhead Cranes, Gantry Cranes, Monorails, Hoists, and Trolleys-General Instruction No 1-2TѓzŒн?н—н н|БVд=PPєzCode d installation du gaz naturel et du propane-Treizieme EeitionTєzBнAнЂн н|Бјд=PPѕzCode d installation du gaz naturel et du propane-Treizieme EditionTѕzBнCнІн н|Бд=PhіzRemanufacturing and Reconditioning of Drums Used for the Transportation of Dangerous GoodsTіzZнEнЊн н|Бд=PnїzCereals and Pulses - Determination of Hidden Insect Infeqtation - Part 2: Sampling First EditionTїz`нGнЎн н|Бд=PTјz-Animal feeding stuffs Sampling-First EditionŸљzCereals, Pulses and Milled Products - Sampling of Static Batches-First Edition; Cancels and Replaces ISO 950:1979, ISO 951:1979 and ISO 2170:1980Tљz‘нJнИн н|Бјд=PњzŠњzStandard Test Methods for Nondestquctive Measurement of Dry Film Thickness of Nonmagnetic Coatings Applied to a Ferrous Baseg stuffs Sampling-First EditionљzŸљzCereals, Pulses and Milled Products - Sampling of Static Batches-First Edition; Cancels and Replaces ISO 950:1979, ISO 951:1979 and ISO 2170:1980rEыО‘d7 нАƒV)ќЯЂuHаnЯ{'Йe§ЉYЕaЧsы—BюšFРlц’Bюƒ/ЩuЪv ЖJі9а|П V  ™ E м ˆ Д ` б } юšFг+зƒ2о-Мhш”РХ\Д`џI˜йћо.`A2ab]Environmental management systems Requirements with guidance for use-Second EditionTb]Sоофо о|Б„д=Pˆc]Plastics Determination of environmental stress cracking (ESC) of polyethylene Full-notch creep test (FNCT)-First EditionTc]zоощо о|БŒд=Pˆd]Plastics Determination of environmental stress cracking (ESC) of polyethylene Full-notch creep test (FNCT)-First EditionTd]zооыо о|Бфд=Pae]Environmental management systems Requirements with guidance for use-Second EditionTe]Sооэо о|Бйд=Pqf]Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994Tf]cоояо о|Бйд=PTg]7Quality Management Systems - Requirements-Third Edition Th]7Quality Management Systems - Requirements-Third Editionai]Environmental management systems Requirements with guidance for use-Second EditionTi]Sо оѕо о|Б#д=Paj]Environmental management systems Requirements with guidance for use-Second EeitionTj]Sооіо о|Б#д=Pak]Environmental management systems Requirements with guidance for use-Second EditionTk]Sооћо о|Б#д=Pql]Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994Tl]cооџо о|БŒд=Pqm]Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994Tm]cооо о|БŒд=P`n]Information and Documentation - Records Management - Part 1: General-First EditionTn]Rооо о|БŒд=Pco]Information and Documentation - Records Management - Part 2: Guidelines-First EditionTo]Uооо о|БŒе=Pp]Document management - Electronic document file format for long-term preservation - Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionTp]оо о о|БŒд=PTq]8Cover Letter, Contents, Foreword, and Checklist of PagesTњz|нLоМо о|Бд=P”ћzStandard Test Method for Nondestructive Measurement of Dry Film Thickness of Nonconductive Coatings!Applied to a Nonferrous Metal BaseTћz†ооОо о|БVд=P”ќzStandard Test Method for Nondestructive Measurement of Dry Film Thickness of Nonconductive Coatings Applied to a Nonferrous Metal BaseTќz†о оРо о|БVд=PT§z9Standard Test Methods for Measuring Adhesion by Tape TestuЁTўz5Standard Test Method for Film Hardness by Pencil TestrџzStandard Test Method for Resistance of Organic Coatings to the Effects of Rapid Deformation (Impact)Tџzdо$оХо о|БVд=PV{Standard Test Methods for Mandrel Bend Test of Attached Organic CoatingsT{Hо&оЧо о|Бд=Pc{Standard Practice for Testing Water Resistance of Coatings in 100 % Relative HumidityT{Uо(оЩо о|Бд=Pt{Standard Test Method for Evaluation of Painted or Coated Specimens Subjected to Corrosive EnvironmentsT{fо*оЫо о|Бд=Pl{General requirements for the competence of testing and calibration laboratories-Second editionT{^о,оЯо о|Бд=Pl{General requirements for the competence of testing and calibqation laboratories-Second editionT{^о.обо о|Бд=Pl{General requirements for the competence of testing and calibration laboratories-Second editionT{^о0ого о|Бд=Pl{General requirements for the competence of testing and calibration laboratories-Second editionT{^о2одо о|БVд=P’{Quality Management Systems - Guidelines for Performance Improvements-First Edition; ISO 9004: 2000; Supersedes ISO 9004-1-94-CAN/CSAT{„о4о№о о|Бјд=PT{@Steel - Determination of Depth of Decarburization-Second Editionp{Strength design in aluminum/ Commentary on CSA S157-05, Strength design in aluminum-Fourth EditionT{bо7ојо о|Бд=PК{Geometrical Product Specifications (GPS) - Acceptance and Reverification Tests for Coordinate Measuring Machines (CMM) - Part 2: CMMs Used for Measuring Size-Second EditionT{Ќо9оќо о|Бјд=PК{Geometrical Product Specifications (GPS) - Acceptance and Reverification Tests for Coordinate Measuring Machines (CMM) - Part 2: CMMs Used for Measuring Size-Second EditionT{Ќо;оўо о|Бјд=PК{Geometrical Product Specifications (GPS) - Acceptance and Reverification Tests for Coordinate Measuring Machines (CMM) - Part 2: CMMs Used for Measuring Size-Second EditionT{Ќо=оо о|Бјд=Pi{Phase II Environmental Site Assessment-First Edition; General Instruction No 1; Update No 3T{[о?о о о|Бјд=PT{ЈLоCо о|Б)д=P˜€{Plastics - Determination of Charpy Impact Properties - Part 2: Instrumented Impact Test-First Edition; Technical Corrigendum 1: 11-15-1998T€{ŠоBоEо о|Б)д=P{Plastics - Injection moulding of test specimens of thermoplastic materials - Part 1: General principles, and moulding of multipurpose and bar test specimens-First Edition; Supersedes ISO 294: 1995; Amendment 1: 01-15-2001; Amendment 2: 09-01-2005T{іоDоGо о|Б)д=P”‚{Plastics - Determination of tensile properties - Part 1: General principles-First Edition; Corrigendum 1-1994; Amendment 1: 09-01-2005T‚{†оFоIо о|Б)д=Pƒ{“ƒ{Plastics Determination of burning behaviour by oxygen index Part 2: Ambient-temperature test-First Edition; Amendment 1: 01/15/2005о о|Б)д=P‚{”‚{Plastics - Determination of tensile properties - Part 1: General principles-First Edition; Corrigendum 1-1994; Amendment 1: 09-01-2005T‚{†оFоIо о|Б)д=P№Т”f8 мЎ€R$іШšl>тД†X*ќЮ rDшКŒ^0дІxJюР’d6к Ќ ~ hrЦ.к†ЩЛ­ѓŸ/л‡ѕЁ5сu!ЕaѕЁ-йv"ЬxВ ^ v " Ž : ц ’  Џ L ј˜DгКYЄPя›Gѓ‚.ЭyёС`џG˜й%[п-тA "Ф{Single-use medical examination gloves Part 1: Specification for gloves made from rubber latex or rubber solution-First Edition; Supersedes ISO 11193: 1994; Corrigendum 1: 06/15/2005T{Жпп п п|Б)д=PР {Cleanrooms and associated controlled environments Part 2: Specifications for testing and monitoring to prove continued compliance with ISO 14644-1-Première éditionT {Вппп п|Бд=PT!{1Cabinets, Racks, Panels, and Associated EquipmentrщF0ВКЉ@` v"{Conformity Assessment - General Requirements for Bodies Operating Certification of Persons-First EditionT"{hппп п|Бд=PT#{<A DTV Profile for Uncompressed High Speed Digital Interfaces  ]${Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000T${Oпп)п п|Б)д=P]%{Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000T%{Oп п-п п|Б)д=P]&{Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000T&{Oп п/п п|Б)д=P]'{Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000T'{Oпп3п п|Б)д=P…({Document management - Part 5: Application of metadata for the construction and facility management sector-First EditionT({wпп7п п|Бд=P…){Document management - Part 5: Application of metadata for the construction and facility management sector-First EditionT){wпп9п п|Б)д=P]*{Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000T*{Oпп=п п|Б)д=P]+{Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000T+{Oпп?п п|Бд=P],{Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000T,{OппAп п|Бд=P]-{Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000T-{OппEп п|Бд=P].{Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000T.{OппIп п|Бд=PЊ/{Personal!Flotation Devices-Amendment 1: November 1990; Amendment 3: July 1996; Incorporates Amendment 2; Amendment 4: January 1997; Corrigendum: August 2000T/{œппMп п|Б)д=PЙ0{Personal Flotation Devices for Children-Amendment 1: November 1990; Amendment 2: February 1993; Amendment 3: July 1996; Amendment 4: January 1997; Corrigendum: August 2000T0{Ћп пOп п|Бд=PV1{NAS Certification & Qualification of Nondestructive Test Personnel-REV 2T1{Hп"пVп п|Б)д=P2{Information technology - Security techniques - Information security management systems - Requirements-First EditionT2{sп$пZп п|Бд=Po3{Food safety management systems Requirements for any organization in the food chain-ISO 22000:2005T3{aп&п^п п|Б)д=P`4{Information and Documentation - Records Management - Part 1: General-First EditionT4{Rп(пdп п|Б)д=Pc5{Information and Documentation - Records Management - Part 2: Guidelines-First EditionT5{Uп*пfп п|Б)д=PU6{Standard Guide for Accelerated Aging of Sterile Medical Device PackagesT6{Gп,пjп п|Бд=PU7{Standard Guide for Accelerated Aging of Sterile Medical Device PackagesT7{Gп.пlп п|Бд=PЪ8{Financial services UNIversal Financial Industry message scheme Part 1: Overall methodology and format specifications for inputs to and outputs from the ISO 20022 Repository-First EditionT8{Мп0пpп п|Б)д=PЪ9{Financial services UNIversal Financial Industry message scheme Part 1: Overall methodology and format specifications for inputs to and outputs from the ISO 20022 Repository-First EditionT9{Мп2пrп п|Б)д=PЪ:{Financial services UNIversal Financial Industry message scheme Part 1: Overall methodology and format specifications for inputs to and outputs from the ISO 20022 Repository-First EditionT9{Мп4пtп п|Б)д=PЪ;{Financial services UNIversal Financial Industry message scheme Part 1: Overall methodology and format specifications for inputs to and outputs from the ISO 20022 Repository-First EditionT;{Мп6пuп п|Б)д=PЪ<{Financial services UNIversal Financial Industry message scheme Part 1: Overall methodology and format specifications for inputs to amd outputs from the ISO 20022 Repository-First EditionT<{Мп8пyп п|Б)д=Pƒ={Financial services UNIversal Financial Industry message scheme Part 3: ISO 20022 modelling guidelines-First EditionT={uп:п{п п|Б)д=PЪ>{Financial services UNIversal Financial Industry message scheme Part 1: Overall methodology and format specifications for inputs to and outputs erom the ISO 20022 Repository-First EditionT>{Мп<п}п п|Б)д=Pƒ?{Financial services UNIversal Financial Industry message scheme Part 3: ISO 20022 modelling guidelines-First EditionT?{uп>п~п п|Б)д=P@{Financial services UNIversal Financial Industry message scheme Part 4: ISO 20022 XML design rules-First EditionT@{qп@п€п п|Б)д=PA{Financial services UNIversal Financial Industry message scheme Part 4: ISO 20022 XML design rules-First EditionTA{qпBпп п|Б)д=PB{Financial services UNIversal Financial Industry message scheme Part 4: ISO 20022 XML design rules-First EditionTB{qпDпƒп п|Бд=PC{C{Financial services UMIversal Financial Industry message scheme Part 4: ISO 20022 XML design rules-First Editionst EditionTA{qпBпп п|Б)д=PB{B{Financial services UNIversal Financial Industry message scheme Part 4: ISO 20022 XML design rules-First Editionidge case examinatioмzћЇ(дU~*` ‰5kMљ/лНѓŸJіЁMъ–6тsžJє   ч “ щ • 8 ф ‡ 3 ж ‚ % бt ›GТnН` Џ[ўЊVрŒ8x$`џN˜йH8рep˜ŸўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TŸўŠрр{ р р|Бд=P˜ ўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990T ўŠрр€ р р|Бд=PTзўŠ”/р! р р|БFд=P{­ Information Technology Equipment - Safety - Part 1: General Requirements-First Edition; Corrigendum 1:10-2002T*V—9рш р р|Бўд=PTп,8Check Correction Strip Specification-Replaces ANSI X9.40‡™GаhCЊр,Information Systems - Unrecorded Magnetic Tape for Information Intfrchange (9-Track 800 CPI, NRZI; 1600 CPI, PE; and 6250 CPI, GCR)-Formerly ANSI X3.40-1993Tр,œрр? р р|Б д=Pjс,ISO 9000 COLLECTION 1 FRENCH-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004Tс,\р рA р р|Бд=Pcт,ISO 9000 COLLECTION 1-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004Tт,Uр рCр р|Бд=Pjу,ISO 9000 COLLECTION 1 FRENCH-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004Tу,\ррE р р|Б д=Pjф,ISO 9000 COLLECTION 1 FRENCH-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004Tф,\ррI р р|Б д=Paх,Environmental management systems Requirements with guidance for use-Second Edition Tх,SррO р р|Бэд=Paц,Environmental management systems Requirements with guidance for use-Second EditionTц,SррT р р|БHд=Paч,Environmental management systems Requirements with guidance for use-Second EditionTч,SррZ р р|БHд=Pжш,Plastics - Polymers/Resins in the Liquid State or as"Emulsions or Dispersions - Determination of Viscosity Using a Rotational Viscometer with Defined Shear Rate Second Edition; (CEN EN ISO 3219: 1995)Tш,Шрр_ р р|Бд=PTщ,9Essential Oils - Principles of Nomenclature First Edition Tъ,9Essential Oils - Principles of Nomenclature First Edition aы,Environmental management systems Requirements with guidance for use-Second EditionTы,Sррf р р|Б д=Pšь,ELECTRODES, WELDING, MINERAL COVERED, IRON-POWDER, LOW-HYDROGEN MEDIUM AND HIGH TENSILE STEEL, AS WELDED OR STRESS-RELIEVED WELD APPLICATIONTь,Œррj р р|Бд=PЕэ,Ships and Marine Technology - Shipboard Plans for Fire Protection, Life-Saving Appliances and Means of Escape-First Edition; (Contians Color); Corrigendum 1: 6/15/2002Tэ,Ір рn р р|Б д=Pzю,Technical Drawings - General Principles of Presentation - Part 20: Basic Conventions for Lines-First EditionTю,lр"рp р р|Б д=P}я,Technical Drawings - General Principles of Presentation - Part 25: Lines on Shipbuilding Drawings-First EditionTя,oр$рr р р|Б д=PT№,6Laboratory pH Metfrs (Supersedes BS 3422: 1961)-Amd 1;^ё,Glass and Reference Electrodes for Measurement of pH-AMD 5668: October 30, 1987;Tё,Pр'рx р р|Бд=PXђ,Micrometers-Supersedes 39-GP-18a, August 1957 and 39-GP-18M, February 1979Tђ,Jр)р| р р|Бд=PTѓ,/Standard for Electrical Safety In the WorkplaceTє,/Standard for Electrical Safety In the WorkplaceTѕ,/Standard for Electrical Safety In the WorkplaceTі,/Standard for Electrical Safety In the Workplacelї,General requirements for the competence of testing and calibration laboratories-Second editionTї,^р/р р р|Бд=Paј,Environmental management systems Requirements with guidance for use-Second EditionVј,Sр1р‘ р р|Б д=Paљ,Environmental management systems Requirements with guidance for use-Second EditionTљ,Sр3р“ р р|Б д=Paњ,Environmental management systems Requirements with guidance for use-Second EditionTњ,Sр5р• р р|Б д=Paћ,Environmental management systems Requirements with gujdance for use-Second EditionTћ,Sр7р– р р|Б д=Paќ,Environmental management systems Requirements with guidance for use-Second EditionTќ,Sр9р˜ р р|Б д=Pa§,Environmental management systems Requirements with guidance for use-Second EditionT§,Sр;р™ р р|Б д=Paў,Environmental managemenv systems Requirements with guidance for use-Second EditionTў,Sр=рš р р|Б д=Paџ,Environmental management systems Requirements with guidance for use-Second EditionTџ,Sр?р› р р|Б д=Pl-General requirements for the competence of testing and calibration laboratories-Second editionT-^рAрœ р р|Б д=Pl-General requirements for the competence of testing and calibration laboratories-Second editionT-^рCрž р р|Б д=Pc-ISO 9000 COLLECTION 1-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004T-UрEр  р р|Бд=PT-8ISO 9000 COLLECTION 2-INCLUDES ISO 9000 SERIES DOCUMENTST-8ISO 9000 COLLECTION 2-INCLUDFS ISO 9000 SERIES DOCUMENTST-8ISO 9000 COLLECTION 2-INCLUDES ISO 9000 SERIES DOCUMENTST-8ISO 9000 COLLECTION 2-INCLUDES ISO 9000 SERIES DOCUMENTS-Ÿ-Alphanumeric character sets for optical recognition - Part I : Character set OCR-A - Shapes and dimensions of the printed image-Adopted by INCITST-‘рKрЋ р р|Б д=P-^-INCITS Technical Report"for Information Technology - Time-Limited Commands (TLC)LLECTION 2-INCLUDES ISO 9000 SERIES DOCUMENTST-8ISO 9000 COLLECTION 2-INCLUDES ISO 9000 SERIES DOCUMENTS-№?HZ™Ї€[фI (лFF№?HZ™Їhѕ“I(лFF@HZ™Їкxйw#Я{'ФpАD№;к†%бpЛgВQ§œHмˆ4рŒ8рŒ.к† Е;ч 2 о D №  ; ч “ Н i  ДSџžJрŒ"Юk­YЏ[Œ8фLј`џH˜йU)ст R˜ЁўGeneral Requirements for the Competence of Testing and Calibration Laboratories-First Edition; Cancels and Replaces ISO/IEC Guide 25: 1990TЁўŠсс† с с|Бід=P‹,Plastics - Determination of the Melt Mass-Flow Rate (MFR) and the Melt Volume-Flow Rate (MVR) of Thermoplastics-Third EditionT,}ссђ с с|Бд=Pц-Plastics - Determination of Melting Behaviour (Melting Temperature or Melting Range) of Semi-Crystalline Polymers by Capillary Tube and Polarizing-Microscope Methods-Third Edition; Technical Corrigendum 1: 10/15/2002T-иссє с с|Бд=P{.Plastics - Determination of Tensile Properties - Part 1: General Principles-First Edition; Corrigendum 1-1994T.mссі с с|Бд=Pˆ/Plastics - Determination of Tensile Properties - Part 2: Test Conditions for Moulding and Extrusion Plastics-First EditionT/zссј с с|Бд=Pe0Plastics - Determination of Flexural Properties-Fourth Edition; Amendment 1: 02/15/2004T0Wс сњ с с|Бд=PT1>Plastics - Determination of Izod Inpact Strength-Third EditionЗBž2Road Vehicles, and Tractors and Machinery for Agriculture and Forestry - Determination of Burning Behaviour of Interior Materials-Second EditionT2с сў с с|Бд=Pп3Plastics Methods for determining the density of non-cellular plastics Part 1: Immersion method, liquid pyknometer method and titration method-First Edition; Together with 1183-2 and 1183-3 replaces 1183:1987T3бсс с с|Бд=PЂ4Plastics Methods for determining the density of non-cellular plastics Part 2: Density gradient column method-First Edition; Replaces ISO 1183:1987T4”сс с с|Бд=P{5Plastics - Determination of Temperature of Deflection under Load - Part 1: General Test Method-Second EditionT5mсс с с~Бд=P|6Plastics - Determination of Temperature of Deflection under Load - Part 2: Plastics and Ebonite-Second EditionT6nсс с с|Бд=P{7Plastics - Determination of Temperature of Deflection under Load - Part 1: General Test Method-Second EditionT7mсс с с|Бд=PT-PрMс­ с с|Б д=PЇ -Information Systems - Computer Graphics - Graphical Kernel System (GKS) Functional Description-Includes ANSI INCITS 124.1-1985; Replaces ANSI X3.124-1985T -™ссБ с с|Бд=Ps -Overhead and Gantry Cranes (Top Running Bridge, Single or Multiple Girder, Top Running Trolley Hoist)T -eссЕ с с|Б д=Pп -Series 1 Freight Containers - Specification and Testing - Part 1: General Cargo Containers for General Purposes Amendment 1: 1AAA and 1BBB Containers-Fifth Edition; Amendment 1: 03/01/93; Amendment 2: 07/01/98T -бссЙ с с|Б д=Pƒ -Series 1 Freight Containers - Corner Fittings - Specification-Fourth Edition; Corrigendum 1-1990; AS/NZS 3711.3: 1993T -uс сЛ с с|Бд=PT -SlingsЉS”В—G0 G h@GX@GtВ@G,Г‡™GаЈG`-Series 1 Freight Containers - Classification, Dimensions and Ratings-Fifth EditionT-Rс#сП с с|Бд=PЂ-Quality Management Systems - Requirements-Third Edition; ISO 9001: 2000; Supersedes ISO 9001-94-CAN/CSA, ISO 9002-94-CAN/CSA and ISO 9003-94-CAN/CSAT-”с%сУ с с|Бд=PЂ-Quality Management Systems - Requirements-Third Edition; ISO 9001: 2000; Supersedes ISO 9001-94-CAN/CSA, ISO 9002-94-CAN/CSA and ISO 9003-94-CAN/CSAT-”с'сХ с с|Бд=Pj-ISO 9000 COLLECTION 1 FRENCH-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004T-\с)сЬ с с|Бзд=Pl-General requirements for the competence of testing and calibration laboratories-Second editionT-^с+са с с|Б д=PT-=Alarm Systems - A Guide to Design, Management and ProcurementT-=Alarm Systems - A Guide to Design, Management and ProcurementT-=Alarm Systems - A Guide to Design, Management and Procurementa-Environmental management systems Requirements with guidance for use-Second EditionT-Sс0со с с|Бд=Pa-Environmfntal management systems Requirements with guidance for use-Second EditionT-Sс2ср с с|Бд=PT-)Quality Management Systems - Requirementsment and Procurementl-General requirements for the competence of testing and calibration laboratories-Second editionT-^с5сч с с|Бчд=Pl-General requirements for the competence of testing and calibratjon laboratories-Second editionT-^с7сщ с с|Бчд=Pa-Environmental management systems Requirements with guidance for use-Second EditionT-Sс9сэ с с|Б д=Pa-Environmental management systems Requirements with guidance for use-Second EditionT-Sс;ся с с|Б д=PT-7Quality Managemfnt Systems - Requirements-Third Editionrementa-Environmental management systems Requirements with guidance for use-Second EditionT-Sс>сћ с с|Бэд=Pa-Environmental management systems Requirements with guidance for use-Second EditionT-Sс@с§ с с|Бэд=P -Information Technology Equipment Safety Part 1: General Requirements-First Edition; IFC 60950-1:2001, MOD; UL 60950-1; Update 1T -сBс с с|Бд=P{!-Information Technology Equipment - Safety - Part 1: General Requirements-First Edition; Corrigendum 1:10-2002T!-mсDс с с|Б д=P"-{"-Information Technology Equipment - Safety - Part 1: General Requirements-First Edition; Corrigendum 1:10-2002T"-mсFс с с|Бд=PInformation Technology Equipment - Safety - Part 1: General Requirements-First Edition; Corrigendum 1:10-2002T!-mсDс с с|Б д=P"-0‘їIH™у8D@а‘їI € №?€‘їIEK=ЙŸA@“їIEK=ЙŸA@`“їI0РLHp’їI“їIР’їI“їI” ГAЙŸA@“їIRѓm{ >@еZј})šFх‘0мˆ'гrВ^ђžJщ•4рŒ8фx$КfФpЮzЦrя›М h ѕ Ё њ І R з ƒ  Г 8 фBюЛЩuМ4рe+зLј`џI˜йq тџ‚@T­ mртœ т т|Б5д=P#-Information Technology Equipment Safety Part 1: General Requirements-First Edition; IEC 60950-1:2001, MOD; UL 60950-1; Update 1T#-тт т т|Бд=Pa$-Environmental management systems Requirements with guidance for use-Second EditionT$-Sтт т т|Бњд=Pa%-Environmental management systems Requirements with guidance for use-Second EditionT%-Sтт т т|Бњд=Pj,-ISO 9000 COLLECTION 1 FRENCH-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004T,-\тт, т т|Бд=Pa--Environmental management systems Requirements witj guidance for use-Second EditionT--Sт т4 т т|БПд=P†0-Plastics - Generic identification and marking of plastics products (ISO 11469:2000); English version of DIN EN ISO 11469T0-xт т@ т т|Б д=PTL-;Coding of Work Injury or Disease Information-Second EditionаШFŽM-Acoustics - Expression of the Subjective Magnitude of Sound or Noise Part 2: Mevhod for Calculating Loudness Level-ISO 532: 1975TM-€тт} т т|Бд=PЃN-Standard for the Production, Storage, and Handling of Liquefied Natural Gas (LNG)-TIA:01-1 October 4,2001; Errata 01-1 2/25/2003; TIA 01-2: 10/4/2001TN-•ттƒ т т|Бд=PlO-Guide for Pressure-Relieving and Depressuring Systems-Fourth Edition; Errata February 15, 1999TO-^тт… т т|Бд=PЧP-Recommended Practice for Classification of Locations for Electrical Installations at Petroleum Facilities Classified as Class I, Zone 0, Zone 1, and Zone 2-First Edition; Errata 8/17/98TP-Йтт‡ т т|Бд=PQ-Information Technology - 80 mm (1,23 Gbytes Per Side) and 120 mm (3,95 Gbytes Per Side) DVD-Recordable Disk (DVD-R)-First EditionTQ-тт‰ т т|Бд=P|R-Freight Containers - Coding, Identification and Marking Third Edition-CEN EN ISO 6346: 1995; SNZ NZS/ISO: 1984TR-nтт т т|Бд=P‡S-Self-Propelled Elevating Work Platforms-Second Edition; General Instruction No 1; Update No 2; Supersedes B354.3-M82-CAN3TS-yтт— т т|Б д=PaT-Self-Propellef Boom-Supported Elevating Work Platforms-Second Edition; Update No. 1TT-Sтт™ т т|Б д=PƒU-Graphical symbols Safety colours and safety signs Part 2: Design principles for product safety labels-First EditionTU-uтт т т|Бд=PTV-Product Safety Signs and LabelsјFWH0ВКЉ@ШjW-Guidelines on the Application of ISO 9001:2002 for the Food and Drink Industry-First EditionTW-\т!тЄ т т|Б д=PlX-General requirements for the competence of testing and calibration laboratories-Second editionTX-^т#тЈ т т|Бд=PlY-General requirements for the competence of testing and calibration laboratories-Second editionTY-^т%тЌ т т|Б д>PlZ-General requirements for the competence of testing and calibration laboratories-Second editionTZ-^т'тД т т|Бд=P{[-Information Technology Equipment - Safety - Part 1: General Requirements-First Edition; Corrigendum 1:10-2002T[-mт)тЛ т т|Бд=Pq\-Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1:94T\-cт+тТ т т|Б д=Pq]-Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T]-cт-тФ т т|Б д=Pq^-Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T^-cт/тХ т т|Б д=Pq_-Quality Managemenv Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T_-cт1тЧ т т|Б д=Pq`-Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T`-cт3тЩ т т|Б д=Pqa-Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994Ta-cт5тЪ т т|Б д=Pqb-Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994Tb-cт7тЬ т т|Б д=Pc-Geometrical Product Specifications (GPS) - Standard Reference Temperature for Geometrical Product Specification and Verification-Second EditionTc-т9тЮ т т|Бд=Pd-Geometrical Rroduct Specifications (GPS) - Standard Reference Temperature for Geometrical Product Specification and Verification-Second EditionTd-т;та т т|Бд=Pe-Geometrical Product Specifications (GPS) - Standard Reference Temperature for Geometrical Product Specification and Verification-Second EditionTe-т=тг т т|Бд=Pf-Geometrical Product Specifications (GPS) -"Standard Reference Temperature for Geometrical Product Specification and Verification-Second EditionTf-т?тз т т|Бд=Pg-Geometrical Product Specifications (GPS) - Standard Reference Temperature for Geometrical Product Specification and Verification-Second EditionTg-тAтй т т|Бд=PTh-*YARN, CORD, SLEEVING, CLOTH AND TAPE-GLASS†i-WATER PURIFICATION UNIT, BASE-MOUNTED, ELECTRIC-MOTOR-DRIVEN, ERDLATOR-TYPE CLARIFIER, DIATOMITE-TYPE FILTERS, 3,000 GPHTi-xтDтф т т|Бд=Pij-Information Technology - Message Handling Systems (MHS): Overall Architecture-Third EditionTj-[тFтч т т|Бд=Pk-ik-Information Technology - Message Handling Systems (MHS): Overall Architecture-Tjird Editioni-†i-WATER PURIFICATION UNIT, BASE-MOUNTED, ELECTRIC-MOTOR-DRIVEN, ERDLATOR-TYPE CLARIFIER, DIATOMITE-TYPE FILTERS, 3,000 GPHTi-xтDтф т т|Бд=Pj-ij-Information Technology - Message Handling Systems (MHS): Overall Architecture-Third EditiЂ@зƒ§ЉUИdЧsж‚х‘є /лjЅQрŒЧV‘=ТnЎBю‚.Ф p  ™ E ф  Е 9 х V  ;ч{'„0ЂNњt Пk­Lј—CД`џI˜йH4ує!Фa&-Environmental management systems Requirements with guidance for use-Second EditionT&-Sуу у у|Бд=Pa'-Environmental management systems Requirements with guidance for use-Second EditionT'-Sуу# у у|Бд=Pa(-Environmental management systems Requirements with guidance for use-Second EditionT(-Sуу% у у|Бд=Pa)-Environmental management systems Requirements with guidance for use-Second EditionT)-Sуу' у у|Бд=PT*-3Standard for Low-, Medium-, and High-Expansion Foam T+-3Standard for Low-, Medium-, and High-Expansion Foam Tk-[тHущ у у|Бд=Pil-Information Technology - Message Handling Systems (MHS): Overall Architecture-Third EditionTl-[у уы у у|Бд=Pim-Information Technology - Message Handling Systems (MHS): Overall Architecture-Third EditionTm-[у ую у у|Б д=Pwn-Information technology Message Handling Systems (MHS) Part 1: System amd service overview-Second EditionTn-iуує у у|Бд=Po-Geometrical Product Specifications (GPS) - Standard Reference Temperature for Geometrical Product Specification and Verification-Second EditionTo-ууі у у|Бд=Pp-Geometrical Product Specifications (GPS) - Standard Reference Temperature for Geometrical Product Specification and Verification-Second EdiuionTp-ууј у у|Бд=Pq-Geometrical Product Specifications (GPS) - Standard Reference Temperature for Geometrical Product Specification and Verification-Second EditionTq-ууќ у у|Бд=Pr-Geometrical Product Specifications (GPS) - Standard Reference Temperature for Geometrical Product Specification and Verification-Second EditionTr-ууў у у|Бд=Pws-Rubber, raw natural Guidelines for the specification of technically specified rubber (TSR)-Sixth EditionTs-iууу у|Бд=Pzt-Crystalline Silicon Terrestrial Photovoltaic (PV) Modules - Design Qualification and Type Approval-Edition 2Tt-lууу у|Б д=Pzu-Crystalline Silicon Terrestrial!Photovoltaic (PV) Modules - Design Qualification and Type Approval-Edition 2Tu-lууу у|Бд=Pav-Environmental management systems Requirements with guidance for use-Second EditionTv-Sууу у|Б д=Pqˆ-Quality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994Tˆ-cу!у*у у|Бд=Pa‰-Environmental management systems Requirements with guidance for use-Second EditionT‰-Sу#у1у у|Бд=PaŠ-Environmental management systems Requirements with guidance for use-Second EditionTŠ-Sу%у3у у|Бд=PЙ‹-Pneumatic fluid power Cylinders with detachable mountings, 1 000 kPa (10 bar) series, bores from 32 mm to 321 mm Basic, mounting and accessories dimensions-First EditionT‹-Ћу'у7у у|Бд=PЋŒ-Small craft - Stability and buoyancy assessment and categorization - Part 1: Non-sailing boats of hull length greater than or equal to 6 m (ISO 12217-1:2002)TŒ-у)у;у у|Б д=PЋ-Small craft - Stability and buoyancy assessment and categorization - Part 1: Non-sailing boats of!hull length greater than or equal to 6 m (ISO 12217-1:2002)T-у+у=у у|Б д=PЋŽ-Small craft - Stability and buoyancy assessment and categorization - Part 1: Non-sailing boats of hull length greater than or equal to 6 m (ISO 12217-1:2002)TŽ-у-у@у у|Б д=PЋ-Small craft - Stability and buoyancy assessment and categorization - Part 1: Non-sailing boats of hull length greater than or equal to 6 m (ISO 12217-1:2002)T-у/уBу у|Б д=PЋ-Small craft - Stability and buoyancy assessment and categorization - Part 1: Non-sailing boats of hull length greater than or equal to 6 m (ISO 12217-1:2002)T-у1уCу у|Б д=P€‘-Insert, Screw Thread, Helical Coil, Inch Series, Coarse and Fine Thread, Standard Assembly Dimensions!for-FSC 5340T‘-rу3уEу у|Б д=P‚’-Information technology equipment - Immunity characteristics - Limits and methods of measurement-(AMENDS DS/EN 55024)T’-tу5уLу у|Бд=P]“-Microfilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000T“-Oу7уUу у|Бчд=PŽ”-Medical Suation Equipment - Part 3: Suction Equipment Powered from Vacuum or Pressure Source-Second Edition; Replaces ASTM F 960T”-€у9у[у у|Бзд=Pi•-Information Technology - Code of Practice For Information Security Management-First EditionT–-7Quality Management Systems - Requirements-Third Editionl—-General requirements for the competence of testing and calibration laboratories-Second editionT—-^у=уpу у|БHд=P†˜-Electronic imaging Information stored electronically Recommendations for trustworthiness and reliability-First EditionT˜-xу?уvу у|Бэд=P†™-Electronic imaging Information stored electronically Recommendations for trustworthiness and reliability-First EditionT™-xуAуxу у|Бзд=PTš-2Freight containers Mechanical seals-First Edition T›-2Freight containers Mechanical seals-First Editionnœ-Code of Practice for Safety in Demolition of Structures-First Edition; General Instruction No. 1Tœ-`уEу„у у|Бэд=P-n-Code of Practice for Safety in Demolition of Structures-First Edition; General Instruction No. 1T-`уGу†у у|Бэд=Pls-First Editionœ-nœ-Code of Practice for Safety in Demolition of Structures-First Edition; General Instruction No. 1Tœ-`уEу„у у|Бэд=P>И@`аoMA№?№?HZ™>И@`арrЂNњІ ЬFђ†2Щuч“6т` Œ89Ž:;<‘=„0Я{Ц U    L в ~  А 9 х H єWfu!ЊVэ™0мˆ4р+ЪvС`џE˜й„фЌ1S0a.-Environmental management systems Requirements with guidance for use-Second EditionT.-Sфф8 ф ф|Бд=Pa/-Environmental management systems Requirements with guidance for use-Second EditionT/-Sфф; ф ф|Бд=Pj1-ISO 9000 COLLECTION 1 FRENCH-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004T1-\ффE ф ф|Бд=Pc2-ISO 9000 COLLECTION 1-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004T2-UффG ф ф|Бд=PT3-8ISO 9000 COLLECTION 2-INCLUDES ISO 9000 SERIES DOCUMENTST4-8ISO 9000 COLLECTION 2-INCLUDES ISO 9000 SERIES DOCUMENTSj5-ISO 9000 CNLLECTION 1 FRENCH-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004T5-\ф фK ф ф|Бд=Pc6-ISO 9000 COLLECTION 1-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004T6-Uф фM ф ф|Бд=P™7-Thermal performance of windows, doors and shutters Calculation of thermal transmittance Part 2: Numerical method for frames-First EditionT7-‹ффO ф ф|Бд=Pi8-Information Technology - Code of Practice For Information Security Management-First EditionT8-[ффS ф ф|Бд=Pl9-General requirements for the competence of testing and calibration laboratories-Second editionT9-^ффW ф ф|Б д=Pl:-General requirements for the competence of vesting and calibration laboratories-Second editionT:-^ффY ф ф|Б д=PT•-[у;фgф ф|БЊд=Pwž-Medical Devices - Application of Risk Management to Medical Devices-First Edition; Amendment 1: 3/01/2003Tž-iффŠф ф|Бчд=PwŸ-Medical Devices - Application of Risk Management to Medical Devices-First Edjtion; Amendment 1: 3/01/2003TŸ-iффŒф ф|Бчд=Pl -General requirements for the competence of testing and calibration laboratories-Second editionT -^фф“ф ф|БHд=PlЁ-General requirements for the competence of testing and calibration laboratories-Second editionTЁ-^фф•ф ф|БHд=P†Ђ-Enectronic imaging Information stored electronically Recommendations for trustworthiness and reliability-First EditionTЂ-xффŸф ф|Бзд=PjЃ-ISO 9000 COLLECTION 1 FRENCH-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004TЃ-\ф!фЃф ф|Бчд=PTЄ-8ISO 9000 COLLECTION 2-INCLUDES ISO 9000 SERIES DOCUMENTSЉЅ-Quality management syrtems - Particular requirements for the application of ISO 9001:2000 for automotive production and relevant service part organizationsTЅ-›ф$фЌф ф|БЊд=PaІ-Environmental management systems Requirements with guidance for use-Second EditionTІ-Sф&фЎф ф|БЊд=PfЇ-Wireline Diamond Core Drilling Equipment - System A - Part 1: Metric Units-First EditionTЇ-Xф(фДф ф|Бчд=PdЈ-Rotary Core Diamond Drilling Equipment - System A - Part 1: Metric Units First EditionTЈ-Vф*фИф ф|Бчд=PЉ-Geometrical Product Specifications (GPS) - Standard Reference Temperature for Geometrical Product Specification and Verification-Second EditionTЉ-ф,фОф ф|БЧд=PVЊ-Rafety Code for Material Hoists-Second Edition; General Instruction No 1TЊ-Hф.фРф ф|БHд=PTЋ-3UNIT HEATER, AIR-CIRCULATING, STEAM (SHIPBOARD USE)lz<General requirements for the competence of testing and calibration laboratories-Second editionTz<^ф1фсф ф|Быд=PT{<)Quality Management Systems - RequirementsdВiЗ@XгBГibШЗBЁ|<Maritime Navigation and Radiocommunication Equipment and Systems - Digital Interfaces - Part 1: Single Talker and Multiple Listeners-Second EditionT|<“ф4фєф ф|Бiд=PЙ}<Maritime Navigation and Radiocommunication Equipment and Systems - Digital Interfaces - Part 2: Single Talker and Multiple Listeners, High-Speed Transmission-First EditionT}<Ћф6фіф ф|Бjд=P§~<Maritime Navigation and Radiocommunication Equipment and Systems. Digital Interfaces. Part 410: Multiple Talkers and Multiple Listeners. Ship Systems Interconnection. Transport Profile Requirements and Basic Transport Profile-First EditionT~<яф8фјф ф|Бiд=P№<Maritime Navigation and Radiocommunication Equipment and Systems - Electronic Chart Display and Information System (ECDIS) - Operational and Performance Reruirements, Methods of Testing and Required Test Results-Second EditionT<тф:фњф ф|Бiд=P7€<Maritime Navigation and Radiocommunication Equipment and Systems - Automatic Identification Systems (AIS)- Part 2: Class A Shipborne Equipment of the Universal Automatic Identification System (AIS) - Operational and Performance Requirements, Methods of Test and Required Test Results-First EditionT€<)ф<фќф ф|Бiд=Pž<Maritime navigation and radiocommunication euipment and systems - Radar - Part 5: Guidelines for the use and display of AIS information on radarT<ф>фўф ф|Бiд=PЋ‚<Maritime navigation and radiocommunication equipment and systems Radar Part 5: Guidelines for the use and display of AIS information on radar-Edition 1.0T‚<ф@фф ф|Бд=P…<ISO General Purpose Metric Screw Threads - Tolerances - Part 5: Limits of Sizes for Internal Screw Threads to Mate with Hot-Dip Galvanized External Screw Threads with Maximum Size of Tolerance Position h Before Galvanizing-ISO 965-5: 1998; JFRI/JSAT…<јфBфф ф|Бд=P†<†<ISO General Purpose Metric Screw Threads - Tolerances - Part 5: Limits of Sizes for Internal Screw Threads to Mate vith Hot-Dip Galvanized External Screw Threads with Maximum Size of Tolerance Position h Before Galvanizing-ISO 965-5: 1998; JFRI/JSAce Position h Before Galvanizing-ISO 965-5: 1998; JFRI/JSAT…<јфBфф ф|Бд=P,0лфG*рGБ*рGYјмфGq+рG ,рG‹3№рсGќ,рG•-рG4@ШфG‹.рG$/рGf~ТУ%бšFVБјЄЏ[я›GёЌHєŽ:й…м ˆ 4 Ъ v № œ 0 м p  Ѕ Q к†2ЦrВIѕ\ЅQч“?ыˆ4ЪvС`џM˜йE/хЦRHkƒ<Identification cards Identification of issuers Part 1: Numbering system-ISO/IEC 7812-1:2000Tƒ<]ххх х|Бд=Pk„<Identification cards Identification of issuers Part 1: Numbering system-ISO/IEC 7812-1:2000T„<]ххх х|Бд=PT†<јфDхх х|Бд=PT‡<)Uniform Symbology Specification - CodabarTˆ<)Uniform Symbology Specification - Codabar]‰<Standard Test Methods for Tension Testing of Metallic Materials-AASHTO No.: T68T‰<Oхх#х х|Бд=P]Š<Standard Test Methods for Tension Testing of Metallic Materials-AASHTO No.: T68TŠ<Oх х%х х|Бд=P]‹<Standard Test Methods for Tension Testing of Metallic Materials-AASHTO No.: T68T‹<Oх х'х х|Бд=PTŒ<.Standard Specification for Seamless Brass Tube–<Performance Packagings for Transportation of Dangerous Goods-Supersedes: CAN/CGSB 43-GP-152MP AND 43-GP-153MP; Corrigendum: January 1999T<ˆхц4х х|Быд=P–Ž<Performance Packagings for Transportation of Dangerous Goods-Supersedes: CAN/CGSB 43-GP-152MP AND 43-GP-153MP; Corrigendum: January 1999TŽ<ˆхх6х х|Быд=Pl<General requirements for the competence of testing and calibration laboratories-Second editionT<^хх9х х|Бд=P‰<Medical devices Quality manbgement systems Guidance on the application of ISO 13485:2003-First Edition; ISO/TR 14969:2004T<{хх=х х|Бд=Ph‘<Environmental Management - Environmental Performance Evaluation - Guidelines-First EditionT‘<ZххEх х|Быд=PP’<Industrial Gear Lubrication-Supersedes AGMA 250.04 and AGMA 251.02T’<BххIх х|Бд=Pl“<General requirements for the competence of testing and calibration laboratories-Second editionT“<^ххQх х|Бд=PМ”<Functional Safety of Electrical/Electronic/Programmable Electronic Safety-Related Systems - Part 6: Guidelines on the Application of IEC 61508-2 and IEC 61508-3-First EditionT”<ЎххVх х|Бд=PЪ•<Assembly Tools for Screws and Nuts - Hand Torque Tools - Requirements and Test Methods for Design Conformance Testing, Quality Conformance Testing and Recalibration Procedure-Third EditionT•<МххZх х|Быд=PЪ–<Assembly Tools for Screws and Nuts - Hand Torque Tools - Requirements and Test Methods for Design Conformance Testing, Quality Conformance Testing and Recalibration Procedure-Third EditionT–<Мх х\х х|Быд=Pl—<General requirements for the competence of testing and calibration laboratories-Second editionT—<^х"х`х х|Быд=Pl˜<General requirements for the competence of testing and calibration laboratories-Second editionT˜<^х$хdх х|Быд=P™<Information and documentation Records management processes Metadata for records Rart 1: Principles-First EditionT™<sх&хkх х|Бд=Pš<Writing Paper and Certain Classes of Printed Matter - Trimmed Sizes - A and B Series-First Edition; PNS 302: 1989Tš<qх(хmх х|Бд=PT›<:Recommended Practice for Quality Control of Image Scannersvœ<Recommended Practice for the Requirements and Characteristics of Documents Intended for"Optical ScanningTœ<hх+хqх х|Бд=Pl<General requirements for the competence of testing and calibration laboratories-Second editionT<^х-хuх х|Бд=Plž<General requirements for the competence of testing and calibration laboratories-Second editionTž<^х/хwх х|Бд=PlŸ<General requirements for the competence of testing and calibration laboratories-Second editionTŸ<^х1х{х х|Бд=Pl <General requirements for the competence of testing and calibration laboratories-Second editionT <^х3х}х х|Бд=PlЁ<General requirements for the competence of testing and calibration laboratories-Second editionTЁ<^х5хх х|Бд=PlЂ<General requirements for the competence of testing and calibration laboratories-Second editionTЂ<^х7х‚х х|Бд=PlЃ<General requirements for the competence of testing and calibration laboratories-Second editionTЃ<^х9х„х х|Бд=PlЄ<General requirements for the competence of testing and calibration laboratorifs-Second editionTЄ<^х;х†х х|Бд=PaЅ<Environmental management systems Requirements with guidance for use-Second EditionTЅ<Sх=х‹х х|Бд=PTІ<*YARN, CORD, SLEEVING, CLOTH AND TAPE-GLASSpЇ<Passenger Car Tyres and Rims - Part 1: Tyres (Metric Series)-Sixth Edition; Amendment 1: 5/15/2004TЇ<bхBх“х х|Бд=PlЈ<General requirements for the competence of testing and calibration laboratories-Second editionTЈ<^хBх™х х|Бд=PTЉ<7Quality Management Systems - Requirements-Third EditionaLEnvironmental management systems Requirements with guidance for use-Second EditionTLSхEхШх х|БKд=PaLEnvironmental management systems Requirements with guidance for use-Second EditionTLSхGхЪх х|БKд=PYLOphthalmics Nonprescription Sunglasses and Fashion Eyewear RequirementsTLKхIхах х|БKд=PLqLQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TLcхKхжх х|Бд=PSхGхЪх х|БKд=PLYLOphthalmics Nonprescription Sunglasses and Fashion Eyewear RequirementsTLKхIхах х|БKд=Pf# ƒFˆ†F6‰†Fr)АƒFŠ†FЈŠ†F`pлjЏ[њІEё1нmХdЄPф$аdЄPф$аdšFђsžJоŠЪ Ќ т Ž в ~  О n  В^еС+зAэ™<ш‹7к†2оŠЫ`џK˜йvцIAqLQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TLcцциц ц|Бд=PlLGeneral requirements for the competence of testing and calibration laboratories-Second editionTL^ццмц ц|БKд=Pl LGeneral requirements for the competence of testing and calibration laboratories-Second editionT L^ццоц ц|БKд=P~!LInformation technology Security techniques Code of practice for information security management-Second EditionT!Lpццфц ц|БKд=P~"LInformation technology Security techniques Code of practice for information security management-Second EditionT"Lpцццц ц|БKд=P•#LGuide 62: General Requirements for Bodies Operating Assessment and Certification/Registration of Quality Systems-ISO/IEC Guide 62: 1996T#L‡ц цъц ц|БKд=P^$LThree-Phase Dead-Front Pad-Mounted Distribution Transformers-Erratum; April 1979T$LPц цяц ц|БKд=P^%LThree-Phase Dead-Front Pad-Mounted Distribution Transformers-Erratum; April 1979T%LPццёц ц|БKд=P^&LThree-Phase Dead-Front Pad-Mounted Distribution Transformers-Erratum; April 1979T&LPццђц ц|БKд=P^'LThree-Phase Dead-Front Pad-Mounted Distribution Transformers-Erratum; April 1979T'LPццєц ц|БKд=P^(LThree-Phase Dead-Front Pad-Mounted Distribution Transformers-Erratum; April 1979T(LPцціц ц|БKд=Po)LStandard for Certification of Noise Barriers-First Edition; General Instruction No 1; Update No 2T)Laццќц ц|Бд=Pl*LGeneral requirements for the competence of testing and calibration laboratories-Second editionT*L^ццц ц|БKд=Pa+LEnvironmental management systems Requirements with guidance for use-Second EditionT+LSццц ц|БKд=PН,LMedical Electrical Equipment Part 1: General Requirements for Safety-Second Edition; Amendment 1: 11-1991, Amendment 2: 03-1995, Corrigendum 1: 6-1995, CENELEC EN 60601-1:1990T,LЏцц ц ц|БKд=PV-LNAS Certification & Qualification of Nondestructive Test Personnel-REV 2T-LHцц ц ц|БKд=PV.LNAS Certification & Qualification of Nondestructive Test Personnel-REV 2T.LHц цц ц|БKд=Pl[LGeneral requirements for the competence of testing and calibration laboratories-Second editionT[L^ц"ц ц ц|Бžд=PT\L=Alarm Systems - A Guide to Design, Management and ProcurementT]L=Alarm Systems - A Guide to Design, Management and ProcurementT^L=Alarm Systems - A Guide to Design, Management and Procurement›_LSterilization of Health Care Products - Radiation Sterilization - Selection of Sterilization Dose for a Single Production Batch-First EditionT_Lц'цЋц ц|Бд=PЛ`LIndustrial Automation Systems and Integration - Product Data Representation and Exchange - Part 11: Description Methods: the EXPRESS Language Reference Manual-Second EditionT`L­ц)цАц ц|Б д=PlaLGeneral requirements for the competence of testing and calibration laboratories-Second editionTaL^ц+цЖц ц|Бд=P–bLInformation Technology - Automatic Identification and Data Capture Techniques - Bar Code Symbology Specifications - PDF417-First EditionTbLˆц-цКц ц|Бд=PPcLPin, Straight, Headless (Dowel) (.0002 over Nominal Size)-FSC 5315TcLBц/цОц ц|Бд=PldLGeneral requirements for the competence of testing and calibration laboratories-Second editionTdL^ц1цТц ц|Б д=POeLFIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderTeLAц3цац ц|Бд=POfLFIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderTfLAц5цвц ц|Б д=POgLFIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderTgLAц7цгц ц|Бд=PThL;Sampling Procedures and Tables for Inspection by AttributesH8В RiLIce Cream, Ice Milk and Sherbet-Supersedes 32-GP-163M and 32-GP-176MTiLDц:цмц ц|Б д=PЅjLMeasurement of Liquid Flow in Open Channels - Part 2: Determination of the Stage-Discharge Relation-Second Edition; Technical Corrigendum 1: 08/01/2000TjL—ц<црц ц|Бд=PЅkLMeasurement of Liquid Flow in Open Channels - Part 2: Determination of the Stage-Discharge Relation-Second Edition; Technical Corrigendum 1: 08/01/2000TkL—ц>цтц ц|Бд=PЅlLMeasurement of Liquid Flow in Open Channels - Part 2: Determination of the Stage-Discharge Relation-Second Edition; Technical Corrigendum 1: 08/01/2000TlL—ц@цфц ц|Бд=PЅmLMeasurement of Liquid Flow in Open Channels - Part 2: Determination of the Stage-Discharge Relation-Second Edition; Technical Corrigendum 1: 08/01/2000TmL—цBццц ц|Бд=PЅnLMeasurement of Liquid Flow in Open Channels - Part 2: Determination of the Stage-Discharge Relation-Second Edition; Technical Corrigendum 1: 08/01/2000TnL—цDцьц ц|Бžд=PЅoLMeasurement of Liquid Flow in Open Channels - Part 2: Determination of the Stage-Discharge Relation-Second Edition; Technical Corrigendum 1: 08/01/2000ToL—цFцюц ц|Б д=PЅpLMeasurement of Liquid Flow in Open Channels - Part 2: Determination of the Stage-Discharge Relation-Second Edition; Technical Corrigendum 1: 08/01/2000TpL—цHц№ц ц|Б д=PqLЅqLMeasurement of Liquid Flow in Open Channels - Part 2: Determination of the Stage-Discharge Relation-Second Edition; Technical Corrigendum 1: 08/01/2000ц ц|Б д=PpLЅpLMeasurement of Liquid Flow in Open Channels - Part 2: Determination of the Stage-Discharge Relation-Second Edition; Technical Corrigendum 1: 08/01/2000А?~EHZ™р™бoЪvб}и„п‹ц’э™є NњІWД`НQ§­YУoЏє Б] Е I ѕ Ÿ K ѕ Ё ф  / л o  ЌXњІHє–Bф2оIѕw#ЅQх‘%б`џI˜йэчj аН/LMedical Electrical Equipment Part 1: General Requirements for Safety-Second Edition; Amendment 1: 11-1991, Amendment 2: 03-1995, Corrigendum 1: 6-1995, CENELEC EN 60601-1:1990T/LЏччч ч|БKд=PTqL—цJчёч ч|Б д=PЅrLMeasurement of Liquid Flow in Open Channels - Part 2: Determination of the Stage-Discharge Relation-Second Edition; Technical Corrigendum 1: 08/01/2000TrL—ччѓч ч|Бžд=PTsL=Alarm Systems - A Guide to Design, Management and ProcurementOtLFIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderTtLAччч ч|Бд=PluLGeneral requirements for the competence of testing and calibqation laboratories-Second editionTuL^ччч ч|Бд=P‹vLVentilation for Acceptable Indoor Air Quality-Includes Addenda listed in Appendix H; Supersedes 62: 2001; Errata: 06/03/2005TvL}ч ч ч ч|Бд=P–wLIn Vitro Diagnostic Medical Devices - Information Supplied by the Manufacturer with in Vitro Diagnostic Reagents for Staining in BiologyTwLˆч чч ч|Бд=P–xLIn Vitro Diagnostic Medical Devices - Information Supplied by the Manufacturer with in Vitro Diagnostic Reagents for Staining in BiologyTxLˆччч ч|Бд=P–yLIn Vitro Diagnostic Medical Devices - Information Supplied by the Manufacturer with in Vitro Diagnostic Reagents for Staining in BiologyTyLˆччч ч|Бд=P–zLIn Vitro Diagnostic Medical Devices - Information Supplied by the Manufacturer with in Vitro Diagnostic Reagents for Staining in BiologyTzLˆччч ч|Бд=PT{L1Stability Testing of in Vitro Diagnostic Reagents sG sG06sG8В c|LElimination or Reduction of Risk of Infection Related to In Vitro Diagnostic ReagentsT|LUччч ч}Бд=P€}LHeat Treatment of Steel Raw Materials-Should Be Used Instead of MIL-H-6875, Which Was Cancelled on 2 February 1999T}Lrччч ч|Бд=Pl~LGeneral requirements for the competence of testing and calibration laboratories-Second editionT~L^чч#ч ч|Б д=PlLGeneral requirements for the competence of testing and calibration laboratories-Second!editionTL^чч%ч ч|Б д=PaLEnvironmental management systems Requirements with guidance for use-Second EditionTLSчч0ч ч|Б д=P šLNon-Destructive Testing - Penetrant Testing and Magnetic Particle Testing - Viewing Conditions-Second Edition; Corrected and Reprinted: 01/15/2002TšL’ччhч ч|Бд=PT›L=Standard for the Installation of Lightning Protection SystemsшїGTœL,Electrical Standard for Industrial Machinery'№C0ВќКЉ@РЌLFoodstuffs Methods of analysis for the detection of genetically modified organisms and derived products Qualitative nucleic acid based methods-First EditionTLžч#чuч ч|Бд=PažLEnvironmental management systems Requirements with guidance for use-Qecond EditionTžLSч%чyч ч|Бд=PaŸLEnvironmental management systems Requirements with guidance for use-Second EditionTŸLSч'ч{ч ч|Бд=PT L5Determining the Scratch Resistance of Organic CoatingВQКЉ@ŠЁLResistance of Organic Coatings to Surface Deterioration by Chemical Action (Formerly OPEL 289)-English Translation AvailableTЁL|ч*ч‚ч ч|БQд=P~ЂLRolling Element Bearings - Aircraft Engine, Engine Gearbox, and Accessory Applications - Eddy Current InspectionTЂLpч,ч–ч ч|Бќд=P~ЃLRolling Element Bearings - Aircraft Engine, Engine Gearbox, and Accessory Applications - Eddy Current InspectionTЃLpч.ч˜ч ч|Бќд=P~ЄLRollimg Element Bearings - Aircraft Engine, Engine Gearbox, and Accessory Applications - Eddy Current InspectionTЄLpч0чšч ч|Бќд=PaЅLEnvironmental management systems Requirements with guidance for use-Second EditionTЅLSч2чžч ч|БQд=PTІL@Cranes Offshore cranes Part 1: General-purpose offshore cranesTЇL@Cranes Offshore cranes Part 1: General-purpose offshore cranesTЈL@Cranes Offshore cranes Part 1: General-purpose offshore cranesaЉLEnvironmental management systems Requirements with guidance for use-Second EditionTЉLSч7чЎч ч|БQд=PaЊLEnvironmental management systems Requirements with guidance for use-Second EditionTЊLSч9чВч ч|БQд=PaЋLEnvironmental management!systems Requirements with guidance for use-Second EditionTЋLSч;чЖч ч|Бд=PTЌL/Environmental Compliance Auditing-First EditionT­L,Evaluation environnementale de site, phase IionqЎLStandard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment ProcessTЎLcч?чМч ч|Бд=P2ЏLLignes directrices pour l´audit des systèmes de management de la qualité et/ou de management environnemental-Premiere Edition; Remplace CAN/CSA-ISO 10011-1-94, CAN/CSA-ISO 10011-2-94, CAN/CSA-ISO 10011-3-94, CAN/CSA-ISO 14010-96, CAN/CSA-ISO 14011-96, CAN/CSA-ISO 14012-96TЏL$чAчОч ч|Бд=PTАL.Life Cycle Assessment-General Instruciton No 1nTБL@Guide De Prevention De!La Pollution-Premiere Edition; Fiche No 1YВLPlanification Des Mesures D´Urgence Pour L´Industrie-Fiche No 1TВLKчEчФч ч|Бд=PTГL7Quality Management Systems - Requirements-Third EditionДLЕДLAcoustics - Determination of Sound Power Levels of Noise Sources Using Sound Intensity - Part 1: Measurement at Discrete Points First Edition (CEN EN ISO 9614-1: 1995)´Industrie-Fiche No 1TВLKчEчФч ч|Бд=PTГL7Quality Management Systems - Requirements-Third EditionДL8ж‚)е-ћЇ6тŽ:й…$аoЧsОjь˜ЦHєjТa ЌXЌXА  М [  › G л ‡  Г P ќЈО(д>ъTu!ЕaОjХq`џO˜йtќшуRЫ( b0LTextiles - Domestic Washing and Drying Procedures for Textile Testing-Second EditionT0LTшшш ш|Б д=P^1LThree-Phase Dead-Front Pad-Mounted Distribution Transformers-Erratum; April 1979T1LPшш"ш ш|Б д=P^2LThree-Phase Dead-Front Pad-Mounted Distribution Transformers-Erratum; April 1979T2LPшш$ш ш|Бžд=P„3LSingle-Phase and Three-Phase Distribution Transformers, Types ONAN and LNAN-Eighth Edition; General Instruction No 1-2T3Lvшш'ш ш|Б д=P„4LSingle-Phase and Three-Phase Distribution Transformers, Types ONAN and LNAN-Eighth Edition; General Instruction No 1-2T4Lvшш)ш ш|Бžд=Pl5LGeneral requirements for the competence of testing and calibration laboratories-Second editionT5L^ш ш-ш ш|Бžд=PT6L=Graphical Symbols for Use in the Labelling of Medical DevicesP7LNon-active surgical implants - General requirements-Second EditionT7LBш ш3ш ш|Бžд=Pl8LGeneral requirenents for the competence of testing and calibration laboratories-Second editionT8L^шш7ш ш|Б д=P‚9LISO GUIDE TO THE EXPRESSION OF UNCERTAINTY IN MEASUREMENT-SEE ALSO ANSI Z540.1; COMPANION DOCUMENT TO TO THE ISO VIMT9LtшшEш ш|Бžд=PT:L7Minimum Design Loads for Buildings and Other StructuresT;L9Guide To The Use Of The Wind Lobd Provisions Of ASCE 7-02@xѓ7GjLMobilities and impedances of structures. Part 1: Compendium of frequency response funbtions.T>L\шшWш ш|Бžд=Pj?LMobilities and impedances of structures. Part 1: Compendium of frequency response functions.T?L\шшXш ш|Бžд=PT@L7Quality Management Systems - Requirements-Third Edition˜ YGqALQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TALcшш`ш ш|Бд=PSBLCathodic Electrodeposition Paint, Low-Friction E-Coat for Small PartsTBLEш шfш ш|Бд=PTCL!Medium Build Cathodic ElectrocoatTDL8Electrodeposition Primer - Cathodic ELPO for Small PartsTEL-General Electrodeposition Primer RequirementsЊFLPRIMER, WATERBORNE CATIONIC ENECTROCOAT, HIGH THROW POWER, EDGE CORROSION RESISTANT, 20 MICROMETRE FILM BUILD, INITIAL FILL, BLACK, 180 C BAKING TEMPERATURETFLœш%шnш ш|Бд=PАGLPRIMER, WATERBORNE CATIONIC ELECTROCOAT, 20 MICROMETRE FILM BUILD, INITIAL FILL, BLACK, 180 DEGREES C BAKING TEMPERATURE ***TO BE USED WITH FORD WSS-M99P1111-A***TGLЂш'шpш ш|Бд=PaHLEnvironmental management syrtems Requirements with guidance for use-Second EditionTHLSш)шtш ш|Б д=PaILEnvironmental management systems Requirements with guidance for use-Second EditionTILSш+шxш ш|Б д=PT‚LUniform Fire CodeВ —G0vG hєЅHXцЅHtВ єЅH,Г ‡™GаvGTƒLUniform Fire CodeЕ hЃЂ<З Б ˜dВ З@ЃГ `ШЗBTДLЇчHшЬш ш|Бд=PTЕL†щ шЮш ш|БQд=PЕЖLAcoustics - Determination of Sound Power Levels of Noise Sources Using Sound Intensity - Part 1: Measurement at Discrete Points First Edition (CEN EN ISO 9614-1: 1995)TЖLЇш1шаш ш|Бд=PTЗL@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176lИLGeneral requirements for the competence of testing and calibration laboratories-Second editionTИL^ш4шхш ш|БQд=PTЙL2Safeguarding of machinery-Second Edition; update 1B0 cIј–Ip–IlКLGeneral requirements for the competence of testing and calibration laboratories-Second editionTКL^ш7шэш ш|Бд=PlЛLGeneral requirements for the competence of testing and calibration laboratories-Second editionTЛL^ш9шяш ш|Бд=PTМL$STANDARD BUILDING CODE 1999 EDITIONTНL$STANDARD BUILDING CODE 1999 EDITIONTОL$STANDARD BUILDING CODE 1997 EDITIONlПLGeneral requirements for the competence of testing and calibration laboratories-Second editionTПL^ш>шџш ш|Бд=PSРLStandard Symbols for Welding, Brazing, and Nondestructive ExaminationTРLEш@шш ш|БQд=P”СLStandard Welding Terms and Definitions Including Terms for Adhesive Bonding, Brazing, Soldering, Thermal Cutting, and Thermal SprayingTСL†шBшш ш|Бќд=PaТLEnvironmental management systems Reqvirements with guidance for use-Second EditionTТLSшDш ш ш|БQд=PaУLEnvironmental management systems Requirements with guidance for use-Second EditionTУLSшFшш ш|БQд=PiФLMaterials Resistant to Sulfide Stress Cracking in Corrosive Petroleum Refining EnvironmentsTФL[шHшш ш|БQд=PiХLMaterials Resistant to Sulfide Stress Cracking in Corrosive Petroleum Refining EnvironmentsTХL[шJшш ш|БQд=P~ЦLInformation technology Security techniques Code of practice for information security management-Second EditionTЦLpшLшш ш|Бд=PЧLlЧLGeneral requirements for the competence of testing and calibration laboratories-Second edition[шJшш ш|БQд=PЦL~ЦLInformation technology Security techniques Code of practice for information security management-Second EditionTЦLpшLшш ш|Бд=PтчъF\ ЮFЅшъF>щъF^ ЮFъъFœъъFX.А\ѓŸ6т-Ьxф=щ})е-Сm­Yэ™E<ш”@ь‹7ж‚в~д € , и „ 1 н l  Ф Z  œ H оŠ Ьx$ЂNтŽ>ъ–*жRўz&ШtТ`џJ˜й oщ­c€LISO 9000 COLLECTION 1-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004T€LUщщ-щ щ|Бд=Pa…LEnvironmental management systems Requirements with guidance for use-Second EditionT…LSщщ<щ щ|Бд=P~†LInformation technology Security techniques Code of practice for information security management-Second EditionT†Lpщщ>щ щ|БQд=P~‡LInformation technology Security techniques Code of practice for information security management-Second EditionT‡LpщщHщ щ|Бќд=P~ˆLInformation technology Security techniques Code of practice for information security management-Second EditionTˆLpщщJщ щ|БQд=P”ЕLRoad Vehicles - Test Methods for Electrical Disturbances from Electrostatic Discharge-First Edition; Cancels and Replaces ISO TR 10605TЧL^шNщщ щ|БQд=PlШLGeneral requirements for the competence of testing and calibration laboratories-Second editionTШL^щ щ!щ щ|Бд=PcЩLISO 9001 COLLECTION 1-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004TЩLUщщ%щ щ|Бќд=PcЪLISO 9000 COLLECTION 1-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004TЪLUщщ'щ щ|Бќд=PcЫLISO 9000 COLLECTION 1-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004TЫLUщщ)щ щ|БQд=PcЬLISO 9000 COLLECTION 1-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004TЬLUщщ+щ щ|БQд=PQЭLPhosphate Coating Final Sealant (Passivation) Rinse for Small PartsTЭLCщщ/щ щ|Бќд=PTЮLPhosphate - Small Parts0рЅH hє+JXц+JtВќє+J,Гќ‡™GашЅHTЯL%Painted Part Performance Requirementsц+JtВќє+J,Гќ‡™GашЅHTаL(Throw Power of Electrodeposition PrimerstВќє+J,Гќ‡™GашЅH~тLInformation technology Security techniques Code of practice for information security management-Second EditionTтLpщщ`щ щ|Бќд=PЃуLMaritime Navigation and Radiocommunication Equipment and Systems - General Requirements - Methods of Testing and Required Test Results-Fourth EditionTуL•щщeщ щ|Бд=PЃфLMaritime Navigation and Radiocommunication Equipment and Systems - General Requirements - Methods of Testing and Required Test Results-Fourth EditionTфL•щщgщ щ|Бд=PЃхLMaritime Navigation and Radiocommunication Equipment and Systems - General Requirements - Methods of Testing and Required Test Results-Fourth EditionTхL•щ!щkщ щ|Бд=PЃцLMaritime Navigation and Radiocommunication Equipment and Systems - General Requirements - Methods of Testing and Required Test Results-Fourth EditionTцL•щ#щmщ щ|Бд=PЃчLMaritime Navigation and Radiocommunication Equipment and Systems - General Requirements - Methods of Testing and Required Test Results-Fourth EditionTчL•щ%щpщ щ|Бд=PlшLGeneral requirements for the competence of testing and calibration laboratories-Second editionTшL^щ'щtщ щ|Бд=PTщL9Passenger Car Tyres and Rims - Part 2: Rims-Third EditionlъLGeneral requirements for the competence of testing and calibration laboratories-Second editionTъL^щ*щ|щ щ|Бќд=PTыL*YARN, CORD,!SLEEVING, CLOTH AND TAPE-GLASSTьL*YARN, CORD, SLEEVING, CLOTH AND TAPE-GLASSЃэLMaritime Navigation and Radiocommunication Equipment and Systems - General Requirements - Methods of Testing and Required Test Results-Fourth EditionTэL•щ.щˆщ щ|БQд=P]юLMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000TюLOщ0щщ щ|БQд=PlяLOccupational health and safety management systems Specification-AMD 14223: December 13, 2002;TяL^щ2щ”щ щ|Бд=Pl№LOccupational health and safety management systems Specification-AMD 14223: December 13, 2002;T№L^щ4щ—щ щ|Бд=PlёLOccupational health and safety management systems Specification-AMD 14223: December 13, 2002;TёL^щ6щ™щ щ|Бд=PŽђLOccupational health and safety management systems Guidelines for the implementation of OHSAS 18001-AMD 14224: December 13, 2002TђL€щ8щšщ щ|Бд=PTѓL7TL 9000 Quality Management System Requirements HandbookTєL7TL 9000 Quality Management System Requirements HandbookpѕLLighting and Marking of Agricultural Equipment on Highways-Fourth Edition; ANSI/ASAE S279.11 Dec02TѕLbщ<щЉщ щ|БQд=PlіLGeneral requirements for the competence of testing and calibration laboratories-Second edition~їLInformation technology Security techniques Code of practice for information security management-Second EditionTїLpщ?щДщ щ|Бgд=PŸјLFinancial transaction card originated messages Interchange message specifications Part 1: Messages, data elements and code values-First EditionTјL‘щAщНщ щ|Б д=PŸљLFinancial transaction card originated messages Interchange message specifications Part 1: Messages, data elements and code values-First EditionTљL‘щCщПщ щ|Б д=PaњLEnvironmental management systems Requirements with guidance for use-Second EditionTњLSщEщУщ щ|Б д=PЛћLFinancial transaction card originated messages Interchange message specifications Part 3: Maintenance procedures for messages, data elements and code values-Second EditionTћL­щGщХщ щ|Б д=PќLЛќLFinancial transaction card originated messages Interchange message specifications Part 3: Maintenance procedures for messages, data elements and code values-Second Editionansaction card originated messages Interchange message specifications Part 3: Maintenance procedures for messages, data elements and code values-Second EditionTћL­щGщХщ щ|Б д=PДR—CтŽя›ќЈ*ОjњІRўpА\№œ0м+ˆ4рŒ Ьx ИСЪ ' г 0 м 9 х g  П k  ЦrЛXЁMъ–*жBюpžJЬxУ`џD˜йDBъQFMТT„LUniform Fire CodeЕ hЃЂ<З Б ˜dВ З@ЃГ `ШЗBTіL^щ>ъЏъ ъ|Бќд=PTќL­щIъЧъ ъ|Б д=PЬ§LFinancial Transaction Card Originated Messages - Interchange Message Specifications - Part 2: Application and Registration Procedures for Institution Identification Codes (IIC)-First EditionT§LОъъЩъ ъ|Б д=PTўL;INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-10th Edition`ШЗBlџLGeneral requirements for the competence of testing and calibration laboratories-Second editionTџL^ъъбъ ъ|Б д=P~MInformation technology Security techniques Code of practice for information security management.Second EditionTMpъъеъ ъ|Б д=P~MInformation technology Security techniques Code of practice for information security management-Second EditionTMpъ ъзъ ъ|Б д=PMAcoustics - Test Code for the Measurement of Airborne Noise Emitted by Rotating Electrical Machines-First EditionTMqъ ълъ ъ~Б д=P~MInformation technology Security techniques Code of practice for information security management-Second EditionTMpъънъ ъ|Б д=P–MStatistical Methods - Guidelines for the Evaulation of Conformity with Specified Requirements - Part 1: General Principles-First EditionTMˆъъхъ ъ|Б д=P–MStatistical Methods - Guidelines for the Evaulbtion of Conformity with Specified Requirements - Part 1: General Principles-First EditionTMˆъъчъ ъ|Б д=POMFIXED LADDERS - SAFETY REQUIREMENTS-Now Copyrighted by ALI/LadderTMAъъыъ ъ|Б д=PЁMGeneral requirements for bodies operating assessment and certification/registration of environmental management systems (EMS)-ISO/IEC GUIDE 66:1999TM“ъъяъ ъ|Бgд=P]MProject 25 Digital Land Mobile Radio Key Fill Device (KFD) Interface ProtocolTMOъъѓъ ъ|Бgд=Pr MSpecification for Drilling and Production Hoisting Equipment-Thirteenth Edition; Addendum 1 May 2001T Mdъъњъ ъ|Бgд=Pд MSafety of Laser Products - Part 1: Equipment Classifibation, Requirements and User´s Guide-Edition 1.2; Edition 1: 1993 Consolidated with Amendments 1: 1997 and 2: 2001; Corrigendum 1: 06/2002T MЦъъўъ ъ|Б_д=P† MInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)T Mxъъъ ъ|Б_д=P† MInformation technology - Security techniques - Code"of practice for information security management (ISO/IEC 17799:2005)T Mxъ ъъ ъ|Б_д=P† MInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)T Mxъ"ъъ ъ|Б_д=P†MInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)TNxъ$ъъ ъ|Б_д=P| MHealth informatics Requirements for an electronic health record architecture-First Edition; ISO/TS 18308:2004T Mnъ&ъ*ъ ъ|Бgд=Pl!MGeneral requirements for the competence of testing and calibration laboratories-Second editionT!M^ъ(ъ.ъ ъ|Бgд=PT"MEarned Value Management Systems<ЗgБ ˜dВgЗ@ЃГg`ШЗBž#MHealth informatics Interoperability of telehealth systems and networks Part 1: Introduction and definitions-First Edition; ISO/TR 16056-1:2004T#Mъ+ъ6ъ ъ|Бgд=P“$MHealth informatics Interoperability of telehealth systems and networks Part 2: Real-time systems-First Edition; ISO/TR 16056-2:2004T$M…ъ-ъ:ъ ъ|Бgд=P]%MProject 25 Digital Land Mobile Radio Key Fill Device (KFD) Interface ProtocolT%MOъ/ъ>ъ ъ|Бgд=P]&MProject 25 Digital Land Mobile Radio Key Fill Device (KFD) Interface ProtocolT&MOъ1ъ@ъ ъ|Бgд=P]'MProject 25 Digital Land Mobile Radio Key Fill Device (KFD) Interface ProtocolT'MOъ3ъDъ ъ|Бgд=Pр(MElectromagnetic compatibility (EMC) - Part 3-2: Limits - Limits for harmonic current emissions (equipment input current <= A per phase)-Edition 2.2; Edition 2:2000 consolidated with amendments 1:2001 and 2:2004T(Mвъ5ъIъ ъ|Б_д=PК)MElectromagnetic compatibility (EMC) - Part 4-11: Testing and measurement techniques - Voltage dips, short interruptions and voltage variations immunity tests-Secnnd EditionT)MЌъ7ъKъ ъ|Б_д=PК*MElectromagnetic compatibility (EMC) - Part 4-11: Testing and measurement techniques - Voltage dips, short interruptions and voltage variations immunity tests-Second EditionT*MЌъ9ъMъ ъ|Б_д=PК+MElectromagnetic compatibility (EMC) - Part 4-11: Testing and measurement techniques - Voltage dips, short interruptions and voltage vbriations immunity tests-Second EditionT+MЌъ;ъOъ ъ|Б_д=PК,MElectromagnetic compatibility (EMC) - Part 4-11: Testing and measurement techniques - Voltage dips, short interruptions and voltage variations immunity tests-Second EditionT,MЌъ=ъQъ ъ|Б_д=PЦ-MElectromagnetic Compatibility (EMC) - Part 4-14: Testing and Measurement Techniques - Voltage Fluctuation"Immunity Test-Edition 1.1; Edition 1: 1999 Consolidated with Amendment 1: 2001T-MИъ?ъSъ ъ|Б_д=PŸ.MElectromagnetic compatibility (EMC) Part 4-4: Testing and measurement techniques Electrical fast transient/burst immunity test-Second EditionT.M‘ъAъUъ ъ|Б_д=P/MŸ/MElectromagnetic compatibility (EMC) Part 4-4: Testing and measurement technirues Electrical fast transient/burst immunity test-Second EditionP.MŸ.MElectromagnetic compatibility (EMC) Part 4-4: Testing and measurement techniques Electrical fast transient/burst immunity test-Second EditionT.M‘ъAъUъ ъ|Б_д=P”вCрZ–FРE–F€F–F€Z–FЃAЂNˆ4z&l^ PќШkКf Е"Ю0мˆШLјr˜DО j ф  М h і Ђ E ё P ќ­YУoй…Г4рb<а|(\Д`џG˜йL4ы [RœT/M‘ъCWы ы|Б_д=Pš0MELECTRODES, WELDING, MINERAL COVERED, IRON-POWDER, LOW-HYDROGEN MEDIUM AND HIGH TENSILE STEEL, AS WELDED OR STRESS-RELIEVED WELD APPLICATIONT0MŒыы\ы ы|Б_д=P‰1MAcoustics - Determination of Sound Power Levels of Noise Sources - Guidelines for the Use of Basic Standards-Second EditionT1M{ыы`ы ы|Бgд=Ph2MSpecification for Fusion Welding for Aerospace Applications-Incorporating Errata - 07/2001T2MZыыeы ы|Б_д=Pq3MQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T3Mcыыiы ы|Б_д=Pq4MQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T4Mcы ыkы ы|Б_д=Pж5MGuidelines for Quality and/or Environmental Management Systems Auditing-First Edition; Replaces ISO 10011-1:1990, ISO 10011-2:1991, ISO 10011-3:1991, ISO 14010:1996, ISO 14011:1996, and ISO 14012:1996T5MШы ыmы ы|Б_д=Pƒ6MQublity Management Systems - Fundamentals and Vocabulary-Second Edition; Supersedes ISO 9000-1:1994 and ISO 8402:1994T6Muы ыoы ы|Б_д=P7MInformation Technology - 80 mm (1,23 Gbytes Per Side) and 120 mm (3,95 Gbytes Per Side) DVD-Recordable Disk (DVD-R)-First EditionT7Mыыvы ы|Бžд=PЈ8MElectroacoustics - Octave-Band and Fractional-Octave-Band Filters-First Fdition; CENELEC EN 61 260: 1995; Supersedes IEC 60225: 1966; Amendment 1: 09 2001T8Mšыыzы ы|Б д=PT9M'Ventilation Standards for the WarehouseT:M'Ventilation Standards for the Warehouseš;MInformation technology - Automatic identification and data capture techniques - Bar code symbology specification - PDF417-ISO/IEC 15438:2001T;MŽыы„ы ы|Бд=PšMInformation technology - Automatic identification and data capture techniques - Bar code symbology specification - PDF417-ISO/IEC 15438:2001T>MŒыыŠы ы|Бд=PT?M)Guide for the Visual Examination of WeldsЫ7MмГ –@MInformation Technology - Automatic Identification and Data Capture Techniques - Bar Code Symbology Specifications - PDF417-First EditionT@Mˆыы’ы ы|Бžд=P^AMPlastics - Generic Identification and Marking of Plastic Products-Second EditionTAMPы ы–ы ы|Бд=PlBMGeneral requirements for the competence of testing and calibration laboratories-Second editionTBM^ы"ыšы ы|Бžд=PlCMGeneral requirements for the competence of testing and calibration laboratories-Second editionTCM^ы$ыœы ы|Бд=PlDMGeneral requirements for the competence of testing and calibration laboratories-Second editionTDM^ы&ыŸы ы|Бд=P\VMFire Protection - Vocabulary - Part 4: Fire Extinction Equipment First EditionTVMNы(ыРы ы|Бžд=P\WMFire Protectjon - Vocabulary - Part 4: Fire Extinction Equipment First EditionTWMNы*ыТы ы|Б д=P\XMFire Protection - Vocabulary - Part 4: Fire Extinction Equipment First EditionTXMNы,ыФы ы|Б д=P\YMFire Protection - Vocabulary - Part 4: Fire Extinction Equipment First EditionTYMNы.ыХы ы|Бд=PbZMSampling Procedures and Tables for Inspection by Variables for Percent NonconformingTZMTы0ыЫы ы|Бд=PG[MPreparation of steel substrates before application of paints and related products - Visual assessment of surface cleanliness - Informative Supplement to part 1: Representative photographic examples of the change of appearance imparted to steel when blast-cleaned with different abrasives-(AMENDS DS/EN ISO 8501-1)T[M9ы2ыЯы ы|Б д=PT\M.STANDARD REQUIREMENTS FOR PRODUCTION MATERIALS0рЛM0рЛM,В T]MGrooved and Shouldered JointshєЫMXцЫMtВєЫM,Г‡™Gаш+Jw^MMedical Devices - Application of Risk Management to Medical Devices-First Edition; Amendment 1: 3/01/2003T^Miы6ыоы ы|Б д=PT_MGrooved and Shouldered JointsЂ`MSampling Procedures for Inspection by Attributes - Part 2: Sampling Plans Indexed by Limiting Quality (LQ) for Isolated Lot Inspection-First EditionT`M”ы9ышы ы|Б д=PЂaMSampling Procedures for Inspection by Attributes - Part 2: Sampling Plans Indexed by Limiting Quality (LQ) for Isolated Lot Inspection-First EditionTaM”ы;ыъы ы|Бд=PЂbMSampling Procedures for Inspection by Attributes - Part 2: Sampling Plans Indexed by Limiting Quality (LQ) for Isolated Lot Inspection-First EditionTbM”ы=ыьы ы|Бд=PTcM1Emergency Preparedness and Response-Third EditionTdM1Emergency Preparedness and Response-Third EditionleMGeneral requirements for the competence of testing and calibration laboratories-Second edivionTeM^ыAыљы ы|Б д=PŒfMInformation Technology - International Symbology Specification - Data Matrix-First Edition; Technical Corrigendum 1: 5/15/2004TfM~ыCыўы ы|Б д=PgM›gMSafety of Machinery - Safety-Related Parts of Control Systems - Part 100: Guidelines for the Use and Application of ISO 13849-1-First EditionTgMыEыы ы|Бžд=Pogy Specification - Data Matrix-First Edition; Technical Corrigendum 1: 5/15/2004TfM~ыCыўы ы|Б д=PK№K0`EKьОYKфф˜рф˜˜нKПYK@ОYK˜K№ЈїJшЌ\KПYK”МYKИмK8ПYKPПYKhПYK€ПYK˜ПYKАЎїJ C\Kр:јJ@B\KР%јJ€&јJ€:рEуW—Cя›љЅЏ ЙeюšFђЋWѕЁEё•Aх‘5сu!ЕaѕЁCя Y  Б  У ) е ; ч M љЅQЉUЦrя›ХqЌ;ч+ЂNД`џG˜йfь#k"ЈИhMInformation Technology - Automatic Identification and Data Capture Techniques - Bar Code Scanner and Decoder Performance Testing-First Edition; Supersedes ISO/IEC 15423-1ThMЊььь ь|Бд=PqiMQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TiMcьь ь ь|Б д=P_jMStandard Method of Test for Determining Water-Soluble Sulfate Ion Content in SoilTjMQььь ь|Бžд=P_kMStandard Method of Test for Determining Water-Soluble Sulfate Ion Content in SoilTkMQььь ь|Бžд=P_lMStandard Method of Test for Determining Water-Soluble Sulfate Ion Content in SoilTlMQььь ь|Бžд=PqmMQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TmMcь ьь ь|Б д=PqnMQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TnMcь ьь ь|Б д=PqoMQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994ToMcььь ь|Бд=PqpMQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TpMcььь ь|Бд=PwqMClinical Investigation of Medical Devices for Human Subjects - Part 1: General Requirements-First EditionTqMiьь$ь ь|Бд=PšƒMELECTRODES, WELDING, MINERAL COVERED, IRON-POWDER, LOW-HYDROGEN MEDIUM AND HIGH TENSILE STEEL, AS WELDED OR STRESS-RELIEVED WELD APPLICATIONTƒMŒььBь ь|Бд=Pi„MRubber, raw natural Guidelines for the specification of technically specified rubber (TSR)T„M[ььDь ь|Б д=Pc…MISO 9000 COLLECTION 1-INCLUDER THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004T…MUььIь ь|Б д=Pˆ†MIdentification cards Integrated circuit cards Part 4: Organization, security and commands for interchange-Second EditionT†MzььMь ь|Б д=Pa‡MEnvironmental management systems Requirements with guidance for use-Second EditionT‡MSььWь ь|Б д=P2ˆMISO STANDARDS COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISO 14001, 14004, 14010, 14011, 14012, DIS 14015, 14020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041, 14042, 14043, TR 14049, 14050, AND TR 14061; SEE ALSO ISO 14000 SERIES AND CDTˆM$ьь[ь ь|Б д=P~‰MInformation technology Security techniques Code of practice for information sfcurity management-Second EditionT‰Mpь ьcь ь|Б_д=P~МMInformation technology Security techniques Code of practice for information security management-Second EditionTМMpь"ьь ь|Бд=PTНM)Small craft Principal data-First editionВQQ,ГQ‡™GаHKTОM)Small craft Principal data-First editionЮFD(ВQЉ@0иLOTПM;Sampling Procedures and Tables for Inspection by AttributesРMTextiles - Tests for Colour Fastness - Part A02: Grey Scale for Assessing Change in Colour-Fourth Edition; CEN EN 20105-A02: 1994TРMь'ь&ь ь|Бќд=PСMTextiles - Tests for Colour Fastness - Part A02: Grey Scale for Assessing Change in Colour-Fourth Edition; CEN EN 20105-A02: 1994TСMь)ь(ь ь|Бќд=PTТM)Small craft Principal data-First editionTУM7Quality Management Systems - Requirements-Third Edition~ФMInformation technology Security techniques Code of practice for information security management-Second EditionTФMpь-ь5ь ь|Бќд=P~ХMInformation technology Security techniques Code of practice for information security management-Second EditionTХMpь/ь7ь ь|Бќд=PlЦMGeneral requirements for the competence of testing and calibration laboratories-Second editionTЦM^ь1ь:ь ь|БQд=PlЉ[General requirements for the competence of testing and calibration laboratories-Second editionTЉ[^ь3ь@ь ь|Бйд=PTЊ[0Automotive Parts - Color Code for Wiring HarnesslЋ[General requirements for the competence of testing and calibration laboratories-Second editionTЋ[^ь6ьHь ь|Ббд=PUЌ[Standard Guide for Accelerated Aging of Sterile Medical Device PackagesTЌ[Gь8ьNь ь|Бйд=P–­[ISO Standards Handbook: Statistical Methods for Quality Control - Volumne 1 - Teminology and Symbols - Acceptance Sampling-Fifth EditionT­[ˆь:ьSь ь|Бйд=PlЎ[General requirements for the competence of testing and calibration laboratories-Second editionTЎ[^ь<ь[ь ь|Б#д=PlЏ[General requirements for the competence of testing and calibration laboratories-Second editionTЏ[^ь>ь_ь ь|Ббд=PА[Geometrical Product Specifications (GPS) - Standard Reference Temperature for Geometrical Product Specification and Verification-Second EditionTА[ь@ьcь ь|Бйд=PьТ[Financial Transaction Card Originated Messages - Interchange Message Specifications Second Edition; (CEN EN ISO 8583: 1995)-Second Edition; CEN EN ISO 8583 :1995; Technical Corrigendum 1: 12/15/1999; Replaced by ISO 8583-1TТ[оьBьƒь ь|Б#д=PьУ[Financial Transaction Card Originated Messages - Interchange Message Specifications Second Edition; (CEN EN ISO 8583: 1995)-Second Edition; CEN EN ISO 8583 :1995; Technical Corrigendum 1: 12/15/1999; Replaced by ISO 8583-1TУ[оьDь…ь ь|Ббд=PФ[ьФ[Financial Transaction Card Originated Messages - Interchange Message Specifications Second Edition; (CEN EN ISO 8583: 1:95)-Second Edition; CEN EN ISO 8583 :1995; Technical Corrigendum 1: 12/15/1999; Replaced by ISO 8583-1Second Edition; CEN EN ISO 8583 :1995; Technical Corrigendum 1: 12/15/1999; Replaced by ISO 8583-1TУ[оьDь…ь ь|Ббд=P˜ыkO1ьkO` СMјьkO‘эkOY ШЪMQюkOъюkOXЧMЉяkOB№z,иь˜ћЇ;ч{'‘=ш”(д€РT‚.А\Д%бBюšFђt Ђ N  Ш g  ‹ 7 д €  У)е^ ™Eд€ЛJі—Cф1нl`џF˜й-Uэ$Q „~ŠMInformation technology Security techniques Code of practice for information security management-Second EditionTŠMpээeэ э|Б_д=PTФ[оьFэ‡э э|Ббд=PИХ[Carbonaceous products for the production of aluminium Baked anodes and shaped carbon products Determination of the coefficient of linear thermal expansion-First EditionTХ[ЊээŒэ э|Б#д=PИЦ[Carbonaceous products for the production of aluminium Baked anodes and shaped carbon products Determination of the coefficient of linear thermal expansion-First EditionTЦ[Њэээ э|Б#д=PлЧ[Carbonaceous materials for the production of aluminium Anodes, cathodes blocks, sifewall blocks and baked ramming pastes Determination of the thermal conductivity using a comparative method-First EditionTЧ[Эээ’э э|Б#д=PЙШ[Carbonaceous materials used in the production of aluminium Baked anodes Determination of the reactivity to carbon dioxide Part 2: Thermogravimetric method-First EditionTШ[Ћэ э”э э|Б#д=P†Щ[Information technology . Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)TЩ[xэ э˜э э|Б#д=P~Ъ[Information technology Security techniques Code of practice for information security management-Second EditionTЪ[pэ эœэ э|Б#д=PTЫ[:Loading on a rigid aeroplane in steady lateral manoeuvres.Gа('CTЬ[:Loading on a rigif aeroplane in steady lateral manoeuvres.Gа('CTЭ[:Loading on a rigid aeroplane in steady lateral manoeuvres.Gа('CTЮ[:Loading on a rigid aeroplane in steady lateral manoeuvres.Gа('CTЯ[:Loading on a rigid aeroplane in steady lateral manoeuvres.Щ`HЗBTа[:Loading on a rigid aeroplane in steady lateral manoeuvres.ц`HЗBUб[General requirements for bodies operating product certification systemsTб[GээРэ э|БДд=PTв[:Loading on a rigid aeroplane in steady lateral manoeuvres.ц`HЗBTг[:Loading on a rigid aeroplane in steady lateral manoeuvres.ц`HЗBTд[:Loading on a rigid aeroplane in steady lateral manoeuvres.с`HЗBTе[7Quality Management Systems - Requirements-Third EditionBГД`HЗBTж[7Quality Management Systems - Requirements-Third EditionBГД`HЗBз[Medical devices Quality management syrtems Requirements for regulatory purposes-Second Edition; ISO 13485: 1996Tз[qээжэ э|Бцд=PTи[:Loading on a rigid aeroplane in steady lateral manoeuvres.Tй[:Loading on a rigid aeroplane in steady lateral manoeuvres.Tк[:Loading on a rigid aeroplane in steady lateral manoeuvres.“л[UL Standard for Safety Attachment Plugs and Receptacles-Fourteenth Edition; Reprint witj Revisions Through and Including May 14, 2004Tл[…э!эшэ э|Бtд=P“м[UL Standard for Safety Attachment Plugs and Receptacles-Fourteenth Edition; Reprint with Revisions Through and Including May 14, 2004Tм[…э#эьэ э|Бtд=Plн[General requirements for the competence of testing and calibration laboratories-Second editionTн[^э%э№э э|БФд=P“о[UL Standard for Safety Attachment Plugs and Receptacles-Fourteenth Edition; Reprint with Revisions Through and Including May 14, 2004Tо[…э'эєэ э|БЌд=P“п[UL Standard for Safety Attachment Plugs and Receptacles-Fourteenth Edition; Reprint with Revisions Through and Including May 14, 2004Tп[…э)эјэ э|БЌд=P“р[UL Standard for Safety Attachment Plugs and Receptacles-Fourteenth Edition; Reprint with Revisions Through and Including May 14, 2004Tр[…э+эќэ э|БЌд=P“с[UL Standard for Safety Attachment Plugs and Receptacles-Fourteenth Edition; Reprint with Revisions Through and Including May 14, 2004Tс[…э-эўэ э|Бюд=P“т[UL Standard for Safety Attachment Plugs and Rfceptacles-Fourteenth Edition; Reprint with Revisions Through and Including May 14, 2004Tт[…э/ээ э|Бюд=PRу[Ventilation for Acceptable Indoor Air Quality-Approved April 6, 2002Tу[Dэ1ээ э|БФд=Pƒф[Quality Management Systems - Fundamentals and Vocabulary-Second Edition; Supersedes ISO 9000-1:1994 and ISO 8402:1994Tф[uэ3э э э|Бœд=Pnх[Information technology - Code of Practice for information security management-ISO/IEC 17799:2000Tх[`э5ээ э|БЌд=Pnц[Information technology - Code of Practice for information security management-ISO/IEC 17799:2000Tц[`э7ээ э|БЌд=Pnч[Information technology - Code of Practice for information security management-ISO/IEC 17799:2000Tч[`э9ээ э|Бœд=Pvш[Electromagnetic compatibility (EMC) - Part 6-2: Generic standards - Immunity for industrial environmentsTш[hэ;э э э|БЌд=Pщ[Electromagnetic compatibility (EMC) - Part 6-4: Generic standards - Emission standard for industrial environmentsTщ[qэ=э"э ю|БЌд=Pнъ[Electromagnetic compatibility (EMC) - Part 4-16: Testing and measurement techniques - Test for immunity to conducted, common mode disturbances in the frequency range 0 Hz to 150 kHz-(AMENDS DS/EN 61000-4-16)Tъ[Яэ?э$э э|Бюд=Pны[Electromagnetic compatibility (EMC) - Part 4-16: Testing and measurement techniques - Test for immunity to conducted, common mode disturbances in the frequency range 0 Hz to 150 kHz.(AMENDS DS/EN 61000-4-16)Tы[ЯэAэ&э э|Бяд=Pn \Mobile Station-Base Station Compatibility Standard for Wideband Spread Spectrum Cellular SystemsT \`эCэ‡э э|Б#д=P \ \International Standards and Recommended Practices - Aeronautical Telecommunications - Volume V Aeronautical Radio Frequency Spectrum Utilization-Second Edition; Incorporates Amendmfnts 71 thru 76; Amendment 77: 11/28/2002, Corrigenda 1: 1/29/02; Supplement: 3/1/2005`эCэ‡э э|Б#д=Pџџџџ1110€?€?€?№у)P№у)P0 *Pьž(Pфф˜рф˜Ÿ(P@ž(P˜ч)Pш *PŸ(P”œ(P8Ÿ(PPŸ(PhŸ(P€Ÿ(P˜Ÿ(PрšуMР…уM€†уM€šуM=лm<ш З8фnЌXъ–(дQ§ЋWФpн‰іЂЛ(дh-š F ђ ž J Ы w # Я { ' г ~ * ж‚.к†2Д`к†ЭyžJ’>†2о`џJ˜йaю$Є@T‹M1Alloy and Temper Designation Systems for AluminumTŒM7Standard Practice for Numbering Metals and Alloys (UNS)TMStandard Specification for Aluminum and Aluminum-Alloy Sheet and PlateTMFююvю ю|БQд=PTŽM:Standard Specification for Stainless Steel Bars and ShapesiMStandard Specification for Free-Cutting Brass Rod, Bar and Shapes for Use in Screw MachinesTM[ююzю ю|Бќд=PWMStandard Specification for Aluminum and Aluminum-Alloy Bar, Rod, and WireTMIюю|ю ю|Бќд=Ps‘MStandard Specification for Aluminum and Aluminum-Alloy Extruded Bars, Rods, Wire, Profiles, and TubesT‘Meю ю~ю ю|Бќд=PS’MStandard Specification for Steel Bar, Carbon and Alloy, Cold-FinishedT’MEю юŠю ю|Бќд=PT“M=Standard Specification for Steel Bars, Alloy, Standard GradesT”M=Standard Specification for Steel Bars, Alloy, Standard Gradesl•MStandard Specification for Steel Bars, Carbon and Alloy, Hot-Wrought, General Requirements forT•M^ююю ю|Бќд=PT–M?Industrial Fans - Performance Testing of Jet Fans-First EditionT—M?Industrial Fans - Performance Testing of Jet Fans-First EditionT˜M?Industrial Fans - Performance Testing of Jet Fans-First Edition~™MInformation technology Security techniques Code of practice for information security management-Second EditionT™Mpююю ю|БQд=PTšM?Industrial Fans - Performance Testing of Jet Fans-First EditionR›MVentilation for Acceptable Indoor Air Quality-Approved April 6, 2002T›MDююЇю ю|БQд=PuœMStandard Specification for Carbon and Alloy Steel Bars Subject to End-Quench Hardenability RequirementsTœMgююЏю ю|Бд=P‚MStandard Specification for Cole-Drawn, Stress-Relieved Carbon Steel Bars Subject to Mechanical Property RequirementsTMtююБю ю|Бд=PRžMStandard Specification for Steel Bars, Carbon, Quenched and TemperedTžMDююГю ю|Бд=P\ŸMStandard Test Methods and Definitions for Mechanical Testing of Steel ProductsTŸMNююЕю ю|Бд=P o MStandard Specification for Steel Bars, Alloy, Hot-Wrought or Cold-Finished, Quenched and TemperedT Maю!юЗю ю|Бд=PTЁM0ANODIC COATINGS FOR ALUMINUM AND ALUMINUM ALLOYSTЂM0ANODIC COATINGS FOR ALUMINUM AND ALUMINUM ALLOYSXЃMWelded Steel Construction (Metal Arc Welding)-Eighth Edition; Update No. 1TЃMJю%юСю ю|Бќд=P‰ЄMStandard Specification for General Requirements for Ferritic Alloy Steel, Austenitic Alloy Steel, and Stainless Steel TubesTЄM{ю'юХю ю|Бд=PьЅMFinancial Transaction Card Originated Messages - Interchange Message Specifications Second Edition; (CEN EN ISO 8583: 1995)-Second Edition; CEN EN ISO 8583 :1995; Technical Corrigendum 1: 12/15/1999; Replaced by ISO 8583-1TЅMою)юЪю ю|БQд=PcІMISO 9000 COLLECTION 1-INCLUDES THE 2000 REVISIONS OF ISO 9000, ISO 9001, AND ISO 9004TІMUю+южю ю|БQд=PTЇM)Quality Management Systems - Requirements0€PP0€PPd€PP†ЈMInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)TЈMxю.юою ю|БQд=PьЉMFinancial Transaction Card Originated Messages - Interchange Message Specifications Second Edition; (CEN EN ISO 8583: 1995)-Second Edition; CEN EN ISO 8583 :1995; Technical Corrigendum 1: 12/15/1999; Replaced by ISO 8583-1TЉMою0юую ю|БQд=P„ЊMElectrical Apparatus for Explosive Gas Atmospheres - Part 15: Type of Protection "n"-Second Edition; IEC 60079-15:2001TЊMvю2ючю ю|Бд=PT \ эEю‹ю ю|Б#д=PT\ яюю ю|Б#д=P^\Terms and Definitions Used in Connection with Reference Materials-Second EditionT\Pю6ю‘ю ю|БŒд=P“\UL Standard for Safety Attachment Plugs and Receptacles-Fourteenth Edition; Reprint with Revisions Through and Including May 14, 2004T\…ю8юю ю|БЄд=P“\UL Standard for Safety Attachment Plugs and Receptacles-Fourteenth Edition; Reprint with Revisions Through and Including May 14, 2004T\…ю:юЁю ю|БЄд=P‘\Road Vehicles - Electrical Disturbance from Conduction and Coupling - Part 1: Definitions and General Considerations-Second EditionT\ƒю<юЅю ю|Б„д=P‘\Road Vehicles - Electrical Disturbance from Conduction and Coupling - Part 1: Definitions and General Considerations-Second EditionT\ƒю>юЇю ю|Б„д=Pх\Road Vehicles - Electrical Disturbance by Conduction and Coupling - Part 2: Commercial Vehicles with Nominal 24 V Supply Voltage - Electrical Transient Conduction Along Supply Lines Only First Edition-Second!EditionT\зю@юЉю ю|Б„д=P‰\Cleanrooms and associated controlled environments Part 1: Classification of air cleanliness-Première éditionT\{юBю­ю ю|Бфд=PР\Cleanrooms and associated controlled environments Part 2: Specifications for testing and monitoring to prove continued compliance with ISO 14644-1-Première éditionT]ВюDюЏю ю|Ббд=PT\:CONTROL OF HEAT TREATING PROCESSES AND AUXILIARY EQUIPMENTAG,ВЄ\Standard Test Method for Impedance and Absorption of Acoustical Materials Using a Tube, Two Microphones and a Digital Frequency Analysis SystemT\юGюТю ю|Б#д=P\z\Standard Test Method for Sound Absorption and Sound Absorption Coefficients by the!Reverberation Room MethodUIPMENTAG,ВЄ\\Standard Test Method for Impedance and Absorption of Acoustical Materials Using a Tube, Two Microphones and a Digital Frequency Analysis SystemT\юGюТю ю|Б#д=PREAT LAKES FORESTRY CENTRE / CENTRE DE FORESTERIE DES GRANDS LACSЁIŸ= Lј8ф["Ю=щXqŠ6и„0мXФ>ъ–3пѓŸТ j  Т n џ Ћ O ћ Љ U г  ЖdМ>ъ–Bю‚.к†3пlСmА\Д`џJ˜йcя%` 5oь[Billet-Steel Bars for Concrete Reinforcement Metals and Metal Products-General Instruction No 1-2Tь[aяя-я я|Ббд=Paэ[Environmental management systems Requirements with guidance for use-Second EditionTэ[Sяя9я я|Бфд=Paю[Environmental management systems Requirements with guidance for use-Second EditionTю[Sяя;я я|Бфд=Paя[Environmental management systems Requirements with guidance for use-Second EditionTя[Sяя=я я|БЄд=Pa№[Environmental management systems Requirements with guidance for use-Second EditionT№[Sяя?я я|БЄд=Paё[Environmental management systems Requirements with guidance for use-Second EditionTё[Sя яAя я|БЄд=Paђ[Environmental management systems Requirements with guidance for use-Second EditionTђ[Sя яFя я|БЄд=Paѓ[Environmental management systems Requirements with guidance for use-Second EditionTѓ[SяяHя я|БЄд=Paє[Environmental management systems Requirements with guidance for use-Second EditionTє[SяяJя я|БЄд=Paѕ[Environmental management systems Requirements with guidance for use-Second EditionTѕ[SяяLя я|Б„д=Paі[Environmental management systems Requirements with guidance for use-Second EditionTі[SяяNя я|Б„д=Paї[Environmental management systems Requirements with guidance for use-Second EditionTї[SяяQя я|Бфд=P“ј[UL Standard for Safety Attachment Plugs and Receptacles-Fourteenth Edition; Reprint with Revisions Through and Including May 14, 2004Tј[…яяUя я|БЄд=P“љ[UL Standard for Safety Attachmenu Plugs and Receptacles-Fourteenth Edition; Reprint with Revisions Through and Including May 14, 2004Tљ[…яяYя я|БЄд=P“њ[UL Standard for Safety Attachment Plugs and Receptacles-Fourteenth Edition; Reprint with Revisions Through and Including May 14, 2004Tњ[…яя]я я|Б„д=P\International Standards and Recommended Practices - Aeronautical Telecommunicationq - Volume V Aeronautical Radio Frequency Spectrum Utilization-Second Edition; Incorporates Amendments 71 thru 76; Amendment 77: 11/28/2002, Corrigenda 1: 1/29/02; Supplement: 3/1/2005T\lюIяФя я|БŒд=Pz\Standard Test Method for Sound Absorption and Sound Absorption Coefficients by the Reverberation Room MethodT\lя яЦя я|БŒд=P\Standard Test Method for!Impedance and Absorption of Acoustical Materials Using a Tube, Two Microphones and a Digital Frequency Analysis SystemT\я"яШя я|Б#д=P~\Information technology Security techniques Code of practice for information security management-Second EditionT\pя$явя я|Б#д=P|\Paper, Board and Pulps - Measurement of Diffuse Reflectance Factor-Third Edition; Tecinical Corrigendum 1-1998T\nя&яия я|Бфд=Ps\Paper, Board and Pulps - Measurement of Diffuse Blue Reflectance Factor (ISO Brightness)-Third EditonT\eя(якя я|Бйд=P†\Information technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)T\xя*яця я|БЄд=P† \Information technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)T \xя,яшя я|Бйд=P†!\Information technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)T!\xя.яъя я|Бйд=P["\Warehousing, Storage, and Transportation of Cleam and Sterile Medical DevicesT"\Mя0яяя я|Б„д=P*#\Mechanical structures for electronic equipment Dimensions of mechanical structures of the 482,6 mm (19 in) series Part 3-101: Subracks and associated plug-in units-First Edition; Replaces IEC 60297-3, IEC 60297-4, IEC 60297-5-100, IEC 60297-5-102, IEC 60297-5-103, IEC 60297-5-107T#\я2яќя я|БЄд=PV$\Luminaires Part 1: General Requirements and Tests-IEC 60598-1: 2003, MODT$\Hя4яя я|Ббд=PV%\Luminaires Part 1: General Requirements and Tests-IEC 60598-1: 2003, MODT%\Hя6яя я|Ббд=PV&\Luminaires Part 1: General Requirements and Tests-IEC 60598-1: 2003, MODT&\Hя8яя я|Б#д=PT'\2Luminaires Part 1: General requirements and testsT(\2Luminaires Part 1: General requirements and tests˜)\Luminaires Part 2: Particular Requirements Section 2.18: Luminaires for Swimming Pools and Similar Applications-AMD 9338 January 15, 1997;T)\Šя<я я я|Б#д=P˜*\Luminaires Part 2: Particular Requirements Section 2.18: Luminaires for Swimming Pools and Similar Applications-AMD 9338 January 15, 1997;T*\Šя>яя я|Бфд=Pk+\ISO 14000 SERIES ON ENVIRONMENTAL MANAGEMENT-SEE ALSO ISO 14000 HDBK AND ISO 14000 COMPENDIUMT+\]я@яя я|Бфд=P[,\Standard for a Versatile Backplane Bus: VMEbus-IEEE Computer Society DocumentT,\MяBяя я|Ббд=P[-\Standard for a Versatile Backplane Bus: VMEbus-IEEE Computer Society DocumentT-\MяDяя я|Ббд=PT.\Line 21 Data Services—G0 КG hTЌHXFЌHtВ#TЌH,Г#‡™Gа(КGl/\General requirements for the competence of testing and calibration laboratories-Second editionT/\^яGя.я я|Б#д=P0\l0\General requirements for the competence of testing and calibration labmratories-Second editionMяDяя я|Ббд=PT.\Line 21 Data Services—G0 КG hTЌHXFЌHtВ#TЌH,Г#‡™Gа(КG/\l/\General requirements for the competence of testing and calibration laboratories-Second editionGЭjцGX№†šGŒkцG)lцGЈƒšG4mцGЭmцGJˆ‘šGЋIн‰5к†+зl€,”@ь˜Bю˜DюšpСmч“ Й3пlœHЪvй … З Ÿ K И d б } ъ–5с€,ЫwТa ЌXїЃBю9и„#Я`џG˜йŒє№K( Ч‰ѕ§­ISO General Purpose Metric Screw Threads - Tolerances - Part 4: Limits of Sizes for Hot-Dip Galvanized External Screw Threads to Mate with Internal Screw Threads Tapped with Tolerance Position H or G After Galvanizing-First EditionT§­ч№№1№ №|Бд=Pљў­ISO General Purpose Metric Screw Threads - Tolerances - Part 5: Limit of Sizes for Internal Screw Threads to Mate with Hot-Dip Galvanized External Screw Threads with Maximum Size of Tolerance Position h Before Galvanizing-First EditionTў­ы№№1№ №|Бд=P–џ­Information technology Coding of audio-visual objects Part 8: Carriage of ISO/IEC 14496 contents over IP networks-ISO/IEC 14496-8:2004Tџ­ˆ№№%1№ №|БУд=PlЎGeneral requirememts for the competence of testing and calibration laboratories-Second editionTЎ^№№)1№ №|БУд=PlЎGeneral requirements for the competence of testing and calibration laboratories-Second editionTЎ^№№+1№ №|Б›д=PlЎGeneral requirements for the competence of testing and calibration laboratories-Second editionTЎ^№ №/1№ №|БУд=PTЎ<A DTV Profile for Uncompressed High Speed Digital Interfaces` ЧЎMeasurement management systems Requirements for measurement processes and measuring equipment-First Edition; ISO 10012: 2003; Replaces ISO 10012-1-97-CAN/CSA and ISO 10012-2-98-CAN/CSATЎЙ№ №71№ №|Бд=P_ЎInformation technology - Service management - Part 1: Specification-First EditionTЎQ№№=1№ №|Бд=PbЎInformation technology - Service management - Part 2: Code of practice-First EditionTЎT№№?1№ №|Бд=PxЎGeneral requirements for the competence of testing and calibration laboratories-Same as IEC/ISO 17025:2005TЎj№№C1№ №|Бд=POЎRailroad Welding Specification - Cars and Locmmotives-Errata:2001TЎA№№L1№ №|Бд=Pq ЎQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T Ўc№№P1№ №|Бд=Pq ЎQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T Ўc№№R1№ №|Бд=PT ЎQuality Management Systems - Fundamentals and Vocabulary-Third EditionT ЎF№№T1№ №|БУд=PT ЎQuality Management Systems - Fundamentals and Vocabulary-Third EditionT ЎF№№V1№ №|БУд=PX ЎStandardization and Related Activities - General Vocabulary-Eighth EditionT ЎJ№№W1№ №|Бд=PXЎStaneardization and Related Activities - General Vocabulary-Eighth EditionTЎJ№!№Y1№ №|Бд=PlЎGeneral requirements for the competence of testing and calibration laboratories-Second editionTЎ^№#№e1№ №|Бд=PеЎAcoustics - Determination of Sound Power Levels of Noise Sources Using Sound Pressure - Engineering Method in an Essentially Free Field over a Reflectine Plane Second Edition; (CEN EN ISO 3744: 1995)TЎЧ№%№j1№ №|Бд=P~"ЎInformation technology Security techniques Code of practice for information security management-Second EditionT"Ўp№'№†1№ №|Бд=PZ#ЎRisk Management - Vocabulary - Guidelines for Use in Standards-First EditionT#ЎL№)№Š1№ №|Б›д=P $ЎReinforced Plastics Based on Unsaturated Polyester Resins - Determination of Residual Styrene Monomer Content First Edition; (AS/NZS 4257.8: 1994)T$Ў’№+№Ž1№ №|Б›д=P2%ЎISO STANDARDS COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISO 14001, 14004, 14010, 14011, 14012, DIS 14015, 14020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041, 14042, 14043, TR 14049, 14050, AND TQ 14061; SEE ALSO ISO 14000 SERIES AND CDT%Ў$№-№“1№ №|Бд=Pa&ЎEnvironmental management systems Requirements with guidance for use-Second EditionT&ЎS№/№•1№ №|Бд=Pƒ'ЎEnvironmental Management Systems - General Guidelines on Principles, Systems and Supporting Techniques-Second EditionT'Ўu№1№—1№ №|Бд=Pq(ЎQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T(Ўc№3№Ÿ1№ №|БУд=PT)Ў<A DTV Profile for Uncompressed High Speed Digital InterfacesT*Ў<A DTV Profile for Uncompressed High Speed Digital Interfaces` iЙAerodrome Design Manual Part 1 Runways Second Edition - 1984-Corrigendum 1 10/21/88; Corrigendum 2 07/31/90; Amendment 1 01/13/91TiЙ№7№А1№ №|Бпд=PTjЙAerodrome Design Manual Part 5 Electrical Systems First Edition - 1983TjЙF№9№В1№ №|Бпд=P]kЙAerodrome Design Manual Part 2 Taxiways, Aprons and Holding Bays-Fourth EditionTkЙO№;№Д1№ №|Бпд=PzlЙAerodrome Design Manual Part 3 Pavements Second Edition - 1983-(Amendment 1 10/25/85) (Amendment 2 08/31/89)TlЙl№=№Ж1№ №|Бпд=P`mЙAerodrome Design Manual - Part 4 Visual Aids-Fourth Edition; Corrigendum: 01/03/04TmЙR№?№И1№ №|Бпд=PTnЙ=Graphical Symbols for Use in the Labelling of Medical DevicesЫoЙSafety of Laser Products - Part 1: Equipment Classification, Requirements and UserДs Guide-AMD 9019: April!1996; AMD 9505: June 1997; AMD 13230: September 24, 2002; CORR 15182: May 20, 2004ToЙН№B№О1№ №|Бпд=PpЙAerodrome Design Manual Part 1 Runways Second Edition - 1984-Corrigendum 1 10/21/88; Corrigendum 2 07/31/90; Amendment 1 01/23/91TpЙ№D№Т1№ №|Б д=PqЙ]qЙAerodrome Design Manual Part 2 Taxiways, Aprons and Holding Bays-Fourth Edition: May 20,!2004ToЙН№B№О1№ №|Бпд=PpЙpЙAerodrome Design Manual Part 1 Runways Second Edition - 1984-Corrigendum 1 10/21/88; Corrigendum 2 07/31/90; Amendment 1 01/23/91TpЙ№D№Т1№ №|Б д=PјMJЅЅ88 xŸ—5ІR‡3п+Б]ЌXu!ЭyД1н|(іЂЎT‚.Y™Eэ ™ A э ™ E ё  , и g  Ф p јЄBю;t Ь`  LрŒіЂЉU`џF˜йD>ёLZBбTqЙO№FЦ1ё ё|Б д=PzrЙAerodrome Design Manual Part 3 Pavements Second Edition - 1983-(Amendment 1 10/25/85) (Amendment 2 08/31/89)TrЙlёёЩ1ё ё|Б д=P`sЙAerodrome Design Manual - Part 4 Visual Aids-Fourth Edition; Corrigendum: 01/03/04TsЙRёёЭ1ё ё|Б д=PTtЙAerodrome Design Manual Part 5 Electrical Systems First Edition - 1983TtЙFёёЯ1ё ё|Б д=P…uЙPiston-Operated Volumetric Apparatus - Part 1: Terminology, General Requirements and User Recommendations-First EditionTuЙwёёж1ё ё|Б д=PZvЙPiston-Operated Volumetric Apparatus - Part 2: Piston Pipeutes-First EditionTvЙLё ёи1ё ё|Б д=PZwЙPiston-Operated Volumetric Apparatus - Part 3: Piston Burettes-First EditionTwЙLё ёк1ё ё|Б д=PyxЙCleanrooms and Associated Controlled Environments - Part 1: Classification of Air Cleanliness-First EditionTxЙkё ёц1ё ё|Б д=PTyЙ$STANDARD BUILDING CODE 1999 EDITION8DD0В КЉ@ˆ lzЙGeneral requirements for the competence of testing and calibration laboratories-Second editionTzЙ^ёё№1ё ё|Бпд=PЧŒЙSampling Procedures for Inspection by Attributes - Part 1: Sampling Schemes Indexed by Acceptance Quality Limit (AQL) for Lot-by-Lot Inspection-Second Edition; Corrigendum 1: 03-01-2001TŒЙЙёё!2ё ё|Б д=PTЙ@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176TŽЙ@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176~ЙInformation technology Security techniques Code of practice for information security management-Second EditionTЙpёё/2ё ё|Бпд=PЙInformation technology - Security techniques - Information security management systems - Requirements-Fiqst EditionTЙsёё12ё ё|Б д=P‰‘ЙPiston-operated volumetric apparatus - Part 1: Terminology, general requirements and user recommendations (ISO 8655-1:2002)T‘Й{ёё52ё ё|Бпд=P’ЙPiston-operated volumetric apparatus - Part 6: Gravimetric methods for the determination of measurement error (ISO 8655-6:2002)T’Йёё72ё ё|Бпд=P‰“ЙPiston-Operated Volumetric Apparatus - Part 6: Gravimetric Methods for the Determination of Measurement Error-First EditionT“Й{ёё92ё ё|Бпд=PP”ЙSafety of Machinery - Principles of Risk Assessment-ISO 14121:1999T”ЙBё ёB2ё ё|Бпд=PP•ЙSafety of Machinery - Principles of Risk Assessment-ISO 14121:1999T•ЙBё"ёD2ё ё|Бпд=Pм–ЙQuality management systems Particular requirements for the application of ISO 9001:2000 for automotive production and relevant service part organizations-Second Edition; Corrected and Reprinted: 12/15/2003T–ЙЮё$ёI2ё ё|Бпд=P—ЙLignes directrices pour lДaudit des systшmes de management de la qualitщ et/ou de management environnemental-Premiere Edition; Remplace CAN/CSA-ISO 10011-1-94, CAN/CSA-ISO 10011-2-94, CAN/CSA-ISO 10011-3-94, CAN/CSA-ISO 14010-96, CAN/CSA-ISO 14011-96, CAN/CSA-ISO 14012-96T—Йё&ёQ2ё ё|Бпд=P~˜ЙInformation technology Security techniques Code of practice for information security management-Second EditionT˜Йpё(ё[2ё ё|Бпд=PZ™ЙSigns and Symbols for the Workplace-Second Edition; General Instruction No 1T™ЙLё*ё_2ё ё|Бпд=PlšЙGeneral requirements for the competence of testing and calibration laboratories-Second editionTšЙ^ё,ёc2ё ё|Б д=PT›Й7Quality Management Systems - Requirements-Third EditionКЉ@` ~œЙInformation technology Security techniques Code of practice for information security management-Second EditionTœЙpё/ёm2ё ё|Б д=PŸЙNon-Incendive Electrical Equipment for Use in Class I, Division 2 Hazardous Locations Industrial Products-First Edition; General Instruction No 1TЙ‘ё1ёs2ё ё|Бпд=PVžЙProcess Control Equipment Industrial Products-General Instruction No 1-5TžЙHё3ёu2ё ё|Бпд=PчŸЙSafety requirements for electrical equipment for measurement, control, and laboratory use Part 2-010: Particular requirements for laboratory equipment for the heating of materials-Second Edition; IEC 61010-1-010:2003TŸЙйё5ё|2ё ё|Бпд=P~ ЙInformation technology Security techniques Code of practice for information security management-Second EditionT Йpё7ё„2ё ё|Б д=PaЁЙEnvironmental management systems Requirements with guidance for use-Second EditionTЁЙSё9ё†2ё ё|Б д=PмЂЙQuality management systems Particular requirements for the application of ISO 9001:2000 for automotive production and relevant service part organizations-Second Edition; Corrected and Reprinted: 12/15/2003TЂЙЮё;ёˆ2ё ё|Б д=PбЃЙGreenhouse gases Part 2:!Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhancements-First EditionTЃЙУё=ё2ё ё|Бпд=P’ЄЙGreenhouse gases Part 3: Specification with guidance for the validation and verification of greenhouse gas assertions-First EditionTЄЙ„ё?ё’2ё ё|Бпд=PTЅЙ/Geographic Information - Metadata-First EditionиВG0ВпКЉ@ш фІЙNatural Gas - Calculation of Calorific Values, Density, and Relative Density and Wobbe Index from Composition-Second Edition; Corrected and Reprinted 02/01/1996; Corrigendum 2: 12/15/1997; Corrigendum 3: 08/01/1999TІЙжёBёš2ё ё|Б д=PЇЙmЇЙSafety of machinery – Electrical equipment of machines – Part 1: General requirements-Edition 5TЇЙ_ёDёž2ё ё|Бпд=Pity and Wobbe Index from Composition-Second Edition; Corrected and Reprinted 02/01/1996; Corrigendum 2: 12/15/1997; Corrigendum 3: 08/01/1999TІЙжёBёš2ё ё|Б д=PPЦЇC>№?(ыЗBфНв/§Рv@Ь{МWњЅ?Ь{МWњЅ?@@ъ}7у§Љи„ЈTѓŸ!Эц’<шIѕw#ЯcЕaуqAэ  I љ Ѕ  Ш ; ч ^ ‰ 5 ЗcЛє 4рŒПeЗcоŠ6т‚.Д`џI˜йlђNi $VЈЙSpecification for Welded Joints in Machinery and Equipment-Third EditionTЈЙHђђЃ2ђ ђ|Б д=PlЉЙGeneral requirements for the competence of testing and calibration laboratories-Second editionTЉЙ^ђђЈ2ђ ђ|Б д=PqМЙQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TМЙcђђб2ђ ђ|Бпд=PaНЙEnvironmental management systems Requirements with guidance for use-Second EditionTНЙSђђе2ђ ђ|Бд=PaОЙEnvironmental management systems Requirements with guidance for use-Second EditionTОЙSђђз2ђ ђ|Бд=PaНЙEnvironmental management systems Requirements with guidance for use-Second EditionTПЙSђ ђл2ђ ђ|Б д=PaРЙEnvironmental management systems Requirements with guidance for use-Second EditionTРЙSђ ђн2ђ ђ|Б д=PaСЙEnvironmental management systems Requirements with guidance for use-Second EditionTСЙSђђп2ђ ђ|Б д=PжТЙGuidelines for Quality and/or Environmental Management Systems Auditing-First Edition; Replaces ISO 10011-1:1990, ISO 10011-2:1991, ISO 10011-3:1991, ISO 14010:1996, ISO 14011:1996, and ISO 14012:1996TТЙШђђх2ђ ђ|Бпд=P{УЙMeasurement Management Systems - Requirements for Measurement Processes and Measuring Equipment-First EditionTУЙmђђч2ђ ђ|Бпд=P{ФЙMeasurement Management Systems - Requirements for Measurement Processes and Measuring Equipment-First EditionTФЙmђђы2ђ ђ|Бд=PmХЙSafety of machinery – Electrical equipment of machines – Part 1: General requirements-Edition 5TХЙ_ђђѓ2ђ ђ|Б д=P“ЦЙAgricultural Wheeled Tractors - Rear-Mounted Three-Point Linkage - Part 1: Categmries 1, 2, 3 and 4-Third Edition; Corrigendum 1-1995TЦЙ…ђђљ2ђ ђ|Бпд=PjЧЙGuidelines on the Application of ISO 9001:2000 for the Food and Drink Industry-First EditionTЧЙ\ђђ3ђ ђ|Бд=P•ШЙConcrete Materials and Methods of Concrete Construction/ Methods of Test and Standard Practices for Concrete-Tenth Edition; Update No 1TШЙ‡ђђ3ђ ђ|Бпд=P…ЩЙElectromagnetic compatibility (EMC) – Part 4-5: Testing and measurement techniques – Surge immunity test-Second EditionTЩЙwђђ 3ђ ђ|Бд=P­ЪЙElectromagnetic compatibility (EMC) – Part 4-3: Testing and measurement techniques – Radiated, radio-frequency, electromagnetic field immunity test-Edition 3.0TЪЙŸђ ђ3ђ ђ|Бд=PmЫЙSafety of machinery – Electrical equipment of machines – Part 1: General requirements-Edition 5TЫЙ_ђ"ђ3ђ ђ|Бпд=PТЬЙQuantities and Procedures for Description and Measurement of Environmental Sound - Part 6: Methods for Estimation of Awakenings Associated with Aircraft Noise Events Heard in HomesTЬЙДђ$ђ3ђ ђ|Б д=PTЭЙ<A DTV Profime for Uncompressed High Speed Digital Interfacesј TЮЙ<A DTV Profile for Uncompressed High Speed Digital Interfacesј TЯЙ Safety ColorsВ —G0РG hД0GXІ0GtВ Д0G,Г ‡™GаШGTаЙ'Environmental and Facility Safety SignsGtВ Д0G,Г ‡™GаШGTбЙCriteria for Safety SymbolsSafety SignsGtВ Д0G,Г ‡™GаШGTвЙ7Safety Tags and Barricade Tapes (for Temporary Hazards)‡™GаШGбгЙ(DRAFT) Primary packaging!materials for medicinal products - Particular requirements for the application of ISO 9001:2000, with reference to Good Manufacturing Practice (GMP) (ISO/DIS 15378:2004)TгЙУђ,ђ@3ђ ђ|Бд=P`дЙQuality management systems Guidelines for configuration management-Second EditionTдЙRђ.ђD3ђ ђ|Бд=PbеЙQuality management systems Guidelines for configuration management-Deuxiшme щditionTеЙTђ0ђF3ђ ђ|Бд=PTжЙ%Verre De Securite Trempe Ou Feuillete`ђЮG0ВКЉ@` ОзЙGeneral Requirements for Bodies Operating Assessment and Certification/Registration of Quality Systems-First Edition; SAA/SNZ HB18.62: 1996; Cancels and Replaces Guide 48; 1986TзЙАђ3ђS3ђ ђ|Бпд=PlщЙGeneral requirements for the competemce of testing and calibration laboratories-Second editionTщЙ^ђ5ђt3ђ ђ|Бпд=PlъЙGeneral requirements for the competence of testing and calibration laboratories-Second editionTъЙ^ђ7ђv3ђ ђ|Бпд=PlыЙGeneral requirements for the competence of testing and calibration laboratories-Second editionTыЙ^ђ9ђx3ђ ђ|Бпд=PlьЙISO 9000 Essentials a Practical Handbook for Implementing the ISO 9000 Standards-Third EditionTьЙ^ђ;ђ|3ђ ђ|Бпд=PэЙDesign and Installation of Earth Energy Systems-First Edition; Replaces CAN/CSA-C445-M92 and C447-94; Update No 1TэЙqђ=ђ†3ђ ђ|Бпд=PЎюЙInformation Processing Systems - Text Communication - Remote Operations - Part 1:!Model, Notation and Service Definition-First Edition; NZS/ISO/IEC 9072.1: 1989TюЙ ђ?ђ3ђ ђ|Бд=PЎяЙInformation Processing Systems - Text Communication - Remote Operations - Part 1: Model, Notation and Service Definition-First Edition; NZS/ISO/IEC 9072.1: 1989TяЙ ђAђ‘3ђ ђ|Бд=Pv№ЙConformity Assessment - General Requirements for Bodies Operating Certificatimn of Persons-First EditionT№ЙhђCђ”3ђ ђ|Бд=PvёЙConformity Assessment - General Requirements for Bodies Operating Certification of Persons-First EditionTёЙhђEђ–3ђ ђ|Бд=PvђЙConformity Assessment - General Requirements for Bodies Operating Certification of Persons-First EditionTђЙhђGђ™3ђ ђ|Бд=Pђ|Бд=PёЙvёЙConformity Assessment - General Requirements for Bodies Operating Certification of Persons-First EditionTёЙhђEђ–3ђ ђ|Бд=PђЙvђЙConformity Assessment - General Requirements for Bodies Operating Certification of Persons-First EditionЎ8фnЄPЂN LЭy ЙMљ9ЭyЛgБ]§Љи„0мˆ4рŒЪv Е  Д / л F ђ ˆ 4 Ё M рŒНBюФcЎZљЅD№;Ъv Ж`џK˜йїѓO‚# 0lѓЙGeneral requirements for the competence of testing and calibration laboratories-Second editionTѓЙ^ѓѓž3ѓ ѓ|Бд=PaєЙEnvironmental management systems Requirements with guidance for use-Second EditionTєЙSѓѓЃ3ѓ ѓ|Бд=P`ѕЙInformation and Documentation - Records Management - Part 1: General-First EditionTѕЙRѓѓЉ3ѓ ѓ|Бпд=PcіЙInformation and Documentation - Records Management - Part 2: Guidelines-First EditionTіЙUѓѓЋ3ѓ ѓ|Бпд=P•їЙInformation and documentation Guidelines for standards drafters for stating records management requirements in standards-First EditionTїЙ‡ѓѓ­3ѓ ѓ|Бпд=P„јЙCopper, lead, zinc and nickel concentrates Experimental methods for checking the precision of sampling-Second EditionTјЙvѓ ѓГ3ѓ ѓ|Б д=P„љЙCopper, lead, zinc and nickel concentrates Experimental methods for checking the precision of sampling-Second EditionTљЙvѓ ѓЖ3ѓ ѓ|Б д=PTњЙ8Quality Management!Systems - Fundamentals and VocabularyКЉ@ш ~ћЙInformation technology Security techniques Code of practice for information security management-Second EditionTћЙpѓѓН3ѓ ѓ|Бпд=P„ќЙCopper, lead, zinc and nickel concentrates Experimental methods for checking the precision of sampling-Second EditionTќЙvѓѓТ3ѓ ѓ|Б д=Pl§ЙGeneral requirements for tie competence of testing and calibration laboratories-Second editionT§Й^ѓѓЦ3ѓ ѓ|Бд=PlўЙGeneral requirements for the competence of testing and calibration laboratories-Second editionTўЙ^ѓѓШ3ѓ ѓ|Бд=PlџЙGeneral requirements for the competence of testing and calibration laboratories-Second editionTџЙ^ѓѓЪ3ё ѓ|Бд=P„КCopper, lead, zinc and nickel concentrates Experimental methods for checking the precision of sampling-Second EditionTКvѓѓЮ3ѓ ѓ|Бд=PlКGeneral requirements for the competence of testing and calibration laboratories-Second editionTК^ѓѓв3ѓ ѓ|Бд=PTК3UNIT HEATER, AIR-CIRCULATING, STEAM (SHIPBOARD USE)H0В КЉ@a PКRequirements for Private Branch Exchange (PBX) Switching EquipmentTКBѓѓо3ѓ ѓ|Б д=PpКTelecommunications Multiline Terminal Systems Requirements for PBX Switching Equipment, Addendum 1TКbѓ ѓр3ѓ ѓ|Б д=PКIdentification Cards - Identification of Issuers - Part 1: Numbering System-Second Edition; Technical Corrigendum 1: 12-15-2001TЙѓ"ѓх3ѓ ѓ|Бд=PКIdentification Cards - Identification of Issuers - Part 2: Application and Registration Procedures-Second EditionTКqѓ$ѓч3ѓ ѓ|Бд=PTК1Dimensional Tolerances for Aluminum Mill ProductsвG0ВпКЉ@№ TК*YARN, CORD, SLEEVING, CLOTH AND TAPE-GLASS`dG0В КЉ@` ] КMicrofilm and Electronic Images as Documenuary Evidence-Amendment 1: April 2000T КOѓ(ѓѕ3ѓ ѓ|Б д=P КInformation technology - Security techniques - Information security management systems - Requirements-First EditionT Кsѓ*ѓџ3ѓ ѓ|Бпд=PT К2Methodes DДEchantillonnage Et DДEssai De La BriqueQH0ВКЉ@` T К=Portable elevating work platforms-Second Edition; Update No 1 b КVehicle-Mounted Aerial Devices-Fourth Edition; General Instruction No 1; Update No 2T КTѓ.ѓ4ѓ ѓ|Бпд=PКIdentification Cards - Identification of Issuers - Part 1: Numbering System-Second Edition; Technical Corrigendum 1: 12-15-2001TКѓ0ѓ 4ѓ ѓ|Бд=PКIdentification Cards - Identification of Issuers - Part 2: Application and Registration Procedures-Seaond EditionTКqѓ2ѓ 4ѓ ѓ|Бд=PTК7Quality Management Systems - Requirements-Third EditionКЉ@ˆ TК@ISO 9001 For Small Business - What To Do - Advice From ISO/TC176TК;INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-10th EditionTC176TК1Dimensional Tolerances for Aluminum Mill ProductslH0В КЉ@ш ’КPipe Threads Where Pressure-Tight Joints Are Not Made on the Threaes - Part 1: Dimensions, Tolerances and Designation-Fourth EditionTК„ѓ8ѓ"4ѓ ѓ|Б д=PГКPaper, board and pulps - Determination of pH of aqueous extracts - Part 1: Cold extraction-First edition; Together with ISO 6588-2 cancels and replaces ISO 6588:1981TКЅѓ:ѓ&4ѓ ѓ|Б д=PlКGeneral requirements for the competence of testing and calibration laboratories-Secone editionTК^ѓ<ѓ*4ѓ ѓ|Бд=PrКConformity Assessment - General Requirements for third-party marks of conformity-ISO/IEC 17030: 2003TКdѓ>ѓ.4ѓ ѓ|Бпд=PrКConformity Assessment - General Requirements for third-party marks of conformity-ISO/IEC 17030: 2003TКdѓ@ѓ04ѓ ѓ|Бпд=PКGeneral Sqecification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558TКѓѓBѓ64ѓ ѓ|Бпд=Pl+КGeneral requirements for the competence of testing and calibration laboratories-Second editionT+К^ѓDѓS4ѓ ѓ|Бпд=Pm,КGeneral requirements for the competence of testing and calibration laboratories-Second editionT,К^ѓFѓU4ѓ ѓ|Бпд=Pl-КGeneral requirements for the competence of testing and calibration laboratories-Second editionT-К^ѓHѓW4ѓ ѓ|Бд=P.Кl.КGeneral requirements for the competence of testing and calibration laboratories-Second editionories-Qecond editionT,К^ѓFѓU4ѓ ѓ|Бпд=P-Кl-КGeneral requirements for the competence of testing and calibration laboratories-Second editionT-К^ѓHѓW4ѓ ѓ|Бд=P‹)Нi§Љ=щш”"Ю\œH•AЏ[Г_ Œ8ЋWѕЁMљx$ЧsЫLј k  Ї S  Џ [ я ›  У W  —CзƒџЋ-й…­)е@ь‰5е Ь`џ<˜йxєPOСœ$"T.К^ѓJ[4є є|Бд=PЛ/КInformation technology - Coding of audio-visual objects - Part 2: Visual-Third Edition; Amendment 1: 06/01/2004; Technical Corrigendum 1: 06/15/2004; Amendment 2: 10/01/2005T/К­єє`4є є|Бд=P{0КInformation technology - Coding of audio-visual objects - Part 3: Audio-Third Edition; Amendment 2: 3/15/2006T0Кmєєb4є є|Бд=P1КInformation technology Coding of audio-visual objects Part 8: Carriage of ISO/IEC 14496 contents over IP networks-First EditionT1Кєєd4є є|Бд=Pt2КInformation technology - Coding of audio-visual objects - Part 10: Advanced Video Coding-Third EditionT2Кfєєf4є є|Бд=PЎ3КInformation technology Coding of audio-visual objects Part 12: ISO base media file format-Second edition; Corrigendum 1: 06/15/2005; Corrigendum 2: 04/01/2006T3К є єh4є є|Бд=P…4КInformation technology Coding of audio-visual objects Part 14: MP4 file format-First Edition; Corrigendum 1: 4/1/2006T4Кwє єj4є є|Бд=PС5КInformation technology Coding of audio-visual objects Part 15: Advanced Video Coding (AVC) file format-First Edition; Technical Corrigendum 1: 2/15/2006; Amendment 1: 03/01/2006T5КГє єl4є є|Бпд=Pr6КInformation technology Coding of audio-visual objects Part 17: Streaming text format-First EditionT6Кdєєn4є є|Бпд=Pa7КEnvironmental management systems Requirements with guidance for use-Second EditionT7КSєєr4є є|Б д=PT8К/Standard Practice for Magnetic Particle Testing`ВtH0В КЉ@` Q9КSafety of Information Technology Equipment-CORR 13834: July 8, 2002T9КCєє†4є є|Бд=P^:КInformation Technology Equipment Routine Electrical Safety Testing in Production T:КPєєˆ4є є|Бд=P›;КSafety of machinery Basic concepts, general principles for design Part 1: Basic terminology, methodology-First Edition; Replaces TR 12100-1T;КєєŒ4є є|Б д=PХ<КAeronautical Telecommunications - Volume III - Communication Systems (Part I - Digital Data Communication Systems; Part II - Voice Communication Systems)-First Edition; Incorpmrating Amendment 71: 11/7/96; Amendment 72: 11/6/97; Amendment 73: 11/5/98; Amendment 74: 11/4/99; Amendment 75: 11/2/00; Amendment 76: 11/1/01; Amendment 77: 11/28/02; Amendment 78: 11/27/03; Amendment 79: 11/25/2004; Supplement: 03/01/05; Amendment 80: 11/24/05T<КЗєє“4є є|Бпд=PХ=КAeronautical Telecommunications - Volume III - Communication Systems (Part I - Digital Data Communication Systems; Part II - Voice Communication Systems)-First Edition; Incorporating Amendment 71: 11/7/96; Amendment 72: 11/6/97; Amendment 73: 11/5/98; Amendment 74: 11/4/99; Amendment 75: 11/2/00; Amendment 76: 11/1/01; Amendment 77: 11/28/02; Amendment 78: 11/27/03; Amendment 79: 11/25/2004; Supplement: 03/01/05; Amendment 80: 11/24/05T=КЗєє•4є є|Бпд=PХ>КAeronautical Telecommunications - Volume III - Communication Systems (Part I - Digital Data Communication Systems; Part II - Uoice Communication Systems)-First Edition; Incorporating Amendment 71: 11/7/96; Amendment 72: 11/6/97; Amendment 73: 11/5/98; Amendment 74: 11/4/99; Amendment 75: 11/2/00; Amendment 76: 11/1/01; Amendment 77: 11/28/02; Amendment 78: 11/27/03; Amendment 79: 11/25/2004; Supplement: 03/01/05; Amendment 80: 11/24/05T>КЗєє—4є є|Бпд=Pi?КFood safety management systems Guidance on the application of ISO 22000:2005-First EditionT?К[є є4є є|Бд=Pa@КEnvironmental management systems Requirements with guidance for use-Second EditionT@КSє"єЁ4є є|Бд=PaAКEnvironmental management systems Requirements with guidance for use-Second EditionTAКSє$єЃ4є є|Бпд=PlBКGeneral requirements for the competence of testing and calibration laboratories-Second editionTBК^є&єЋ4є є|Бд=PTCК7Quality Management Systems - Requirements-Third EditionКЉ@` ƒDКEnvironmental Management Systems - General Guidelines on Principles, Systems and Supporting Techniques-Second EditionTDКuє)єЕ4є є|Б д=PoEКFood safety management systems Requirements for any organization in the food chaim-First EditionTEКaє+єК4є є|Б д=PyFКInformation Technology - Open Systems Interconnection - Common Management Information Service-Third EditionTFКkє-єО4є є|Б д=PвGКInformation Technology - Open Systems Interconnection - Common Management Information Protocol - Part 1: Specification-Third Edition; Technical Corrigendum 1: 12/15/1999; Corrigendum 2: 12/01/2012TGКФє/єР4є є|Б д=PqHКQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994THКcє1єФ4є є|Б д=PyIКInformation Technology - Open Systems Interconnection - Common Management Information Service-Third EditionTIКkє3єШ4є є|Бд=PвJКInformatiom Technology - Open Systems Interconnection - Common Management Information Protocol - Part 1: Specification-Third Edition; Technical Corrigendum 1: 12/15/1999; Corrigendum 2: 12/01/2002TJКФє5єЪ4є є|Бд=P(KКInformation Technology - Open Systems Interconnection - Common Management Information Protocol: Protocol Implementation Conformance Statement (PICS) Proforma-First Edition; Technical Corrigendum 1: 06/15/1993; Technical Corrigeneum 2: 12/15/1996; Technical Corrigendum 3: 12/15/1998TKКє7єЬ4є є|Бд=PЗLКInformation Technology - Open Systems Interconnection - Service Definition for the Association Control Service Element-Second Edition; Amendment 1-1997; Amendment 2-1998TLКЉє9єЮ4є є|Бпд=PMКжMКInformation Technology - Open Systems Interconnection - Protocol Specification eor the Association Control Service Element: Protocol Implementation Conformance Statement (PICS) Proforma-Second Editionion Control Service Element-Second Edition; Amendment 1-1997; Amendment 2-1998TLКЉє9єЮ4є є|Бпд=PЇ0ŸƒEШ“ƒEш”ƒE ќџ@ŸƒE ŸƒEмšƒE8АPŸƒE0ŸƒEшšƒE8*OH №G@ŸƒE№šƒE РEG `BHp№GaЌC8p€ƒE(ƒEЂ@‰5 Йч“ЦU/лbŸKШt Д`џЋJі9t [  B ю S џ Ё M ќЈTѓŸ-йФ?ы=щu!’>УoД`џE˜й`$ѕPRŸ TMКШє;а4ѕ ѕ|Б д=PЎNКInformation Processing Systems - Text Communication - Remote Operations - Part 1: Model, Notation and Service Definition-First Edition; NZS/ISO/IEC 9072.1: 1989TNК ѕѕг4ѕ ѕ|Б д=PžOКInformation Processing Systems - Text Communication - Remote Operations - Part 2: Protocol Specification-First Edition; NZS/ISO/IEC 9072.2: 1989TOКѕѕе4ѕ ѕ|Б д=PTPК;INTERNATIONAL STANDARDS FOR QUALITY MANAGEMENT-10th EditionКЉ@xQКGeneral requirements for the competence of testing and calibration laboratories-Same as IEC/ISO 17025:2005TQКjѕѕн4ѕ ѕ|Б д=PTRК*Digital Television (DTV) Closed Capvioning`вЦH0ВпКЉ@` SКAudio, video and similar electronic apparatus Safety requirements-First Edition; IEC 60065:2001; Supersedes E60065-00-CAN/CSATSКѕ ѕц4ѕ ѕ|Б д=PTКAudio, video and similar electronic apparatus Safety requirements-First Edition; IEC 60065:2001; Supersedes E60065-00-CAN/CSATTКѕ ѕъ4ѕ ѕ|Б д=PUКAudio, video and sinilar electronic apparatus Safety requirements-First Edition; IEC 60065:2001; Supersedes E60065-00-CAN/CSATUКѕ ѕю4ѕ ѕ|Б д=PVКAudio, video and similar electronic apparatus Safety requirements-First Edition; IEC 60065:2001; Supersedes E60065-00-CAN/CSATVКѕѕє4ѕ ѕ|Бд=Pl ЩGeneral requirements for the competence of testing and calibration laboratories-Sfcond editionT Щ^ѕѕќ4ѕ ѕ|Бд=Pl ЩGeneral requirements for the competence of testing and calibration laboratories-Second editionT Щ^ѕѕў4ѕ ѕ|Бд=Pa ЩEnvironmental management systems Requirements with guidance for use-Second EditionT ЩSѕѕ5ѕ ѕ|Бд=Pv ЩCanadian Keyboard Standard fnr the English and French Languages-Second Edition; General Instruction No 1T Щhѕѕ5ѕ ѕ|Бд=P ЩInformation technology Coding of audio-visual objects Part 8: Carriage of ISO/IEC 14496 contents over IP networks-First EditionT Щѕѕ 5ѕ ѕ|Бд=PЩInformation technology Coding of audio-visual objects Part 8: Carriage of ISO/IEC 14496 contents over IP netwnrks-First EditionTЩѕѕ5ѕ ѕ|Бд=PЛЩInformation technology - Coding of audio-visual objects - Part 2: Visual-Third Edition; Amendment 1: 06/01/2004; Technical Corrigendum 1: 06/15/2004; Amendment 2: 10/01/2005TЩ­ѕѕ5ѕ ѕ|Бд=PбЩElectrical apparatus for use in the presence of combustible dust – Part 0: General requirements-First Edition; Together with JEC 61241-1, cancels and replaces IEC 61241-1-1; Corrigendum 1:11/2005TЩУѕѕ5ѕ ѕ|Бд=PžЩElectrical apparatus for use in the presence of combustible dust – Part 11: Protection by intrinsic safety 'iD'-Edition 1; Corrigendum 1: 2/2006TЩѕ!ѕ5ѕ ѕ|Бд=PˆЩElectrical apparatus for use in the presence of combustible dust Part 18: Protection by encapsulation "mD"-First EditionTЩzѕ#ѕ5ѕ ѕ|Бд=PЕЩElectrical Apparatus for Use in Class I, Zones 0, 1 & 2 Hazardous (Classified) Locations: General Requirements-Supersedes ANSI/ISA-12.00.01-2002 (IEC 60079-0 Ed 3 Mod)TЩЇѕ%ѕ5ѕ ѕ|Бд=PзЩElectrical Apparatus for Use in Class I, Zone 1 Hazardous (Classified) Locations Type of Protection Increased Safety "e"-Supersfdes ANSI/ISA-12.16.01-1998; IEC 60079-7 Mod; Second Printing 07/15/2005TЩЩѕ'ѕ5ѕ ѕ|Бд=PЪЩElectrical Apparatus for Use in Class I, Zones 0, 1, & 2 Hazardous (Classified) Locations - Intrinsic Safety "i"-Supersedes ISA-12.02.01-1999; IEC 60079-11 Mod; Second Printing: 07/15/2005TЩМѕ)ѕ 5ѕ ѕ|Бд=PКЩElectrical Apparatus for Use in Class I, Zone 1 Hazardour (Classified) Locations: Type of Protection Encapsulation "m"-Supersedes ANSI/ISA-12.23.01-2002 (IEC 60079-18 Mod)TЩЌѕ+ѕ"5ѕ ѕ|Бд=PЩAudio, video and similar electronic apparatus Safety requirements-First Edition; IEC 60065:2001; Supersedes E60065-00-CAN/CSATЩѕ-ѕ,5ѕ ѕ|Бд=PTЩ9Solid culture media (for veterinary aims). SpecificationsЉ@` ]ЩTUBE, BIOLOGICAL CULTURE SAMPLING, PLEDGET STYLE, WITH TRANSPORT MEDIA, PLASTICTЩOѕ0ѕ55ѕ ѕ|Бд=PlЩGeneral requirements for the competence of testing and calibration laboratories-Second editionTЩ^ѕ2ѕ95ѕ ѕ|Бд=PlЩGeneral requirements for the competence of testing and calibration laboratories-Second editionTЩ^ѕ4ѕ;5ѕ ѕ|Бд=PlЩGeneral requirements for the competence of testing and calibration laboratories-Second editionTЩ^ѕ6ѕ=5ѕ ѕ|Бд=PTЩ.Designation System for Fasteners First Edition`rнC0ВКЉ@` ЩFluid Power Systems and Components - Graphic Symbols and Circuit Diagrams - Part 1: Graphic Symbols-First EditionTЩqѕ9ѕD5ѕ ѕ|Бд=P€ЩFluid Power Systems and Components - Graphic Symbols and Circuit Diagrams - Part 2: Circuit Diagrams-First EditionTЩrѕ;ѕF5ѕ ѕ|Бд=PЌ ЩSound and television broadcast receivers and associated equipment - Radio disturbance characteristics - Limits and methods of measurement-(AMENDS DS/EN 55013)T Щžѕ=ѕN5ѕ ѕ|Бд=Px!ЩGeneral rfquirements for the competence of testing and calibration laboratories-Same as IEC/ISO 17025:2005T!Щjѕ?ѕR5ѕ ѕ|Бд=P]"ЩElektrisk utstyr i eksplosjonsfarlige omgivelse - Eksplosjonssikker utfјrelse dT"ЩOѕAѕV5ѕ ѕ|Бд=P#Щ]#ЩElektrisk utstyr i eksplosjonsfarlige omgivelse - Eksplosjonssikker utfјrelse dT#ЩOѕCѕX5ѕ ѕ|Бд=P?ѕR5ѕ ѕ|Бд=P"Щ]"ЩElektrisk utstyr i eksplosjonsfarlige omgivelse - Eksplosjonssikker utfјrelse dT"ЩOѕAѕV5ѕ ѕ|Бд=P#ЩаsД`ш”ш”РAэ™-йm­YќЈTЧsЙe›Gpg‹7™Et e  ‚ . Ÿ K е  Ь`  LПkоŠ§ЉШtќЈTЖbД`џI˜й<@іQQE8]$ЩElektrisk utstyr i eksplosjonsfarlige omgivelse - Eksplosjonssikker utfјrelse dT$ЩOііZ5і і|Бд=PT6Щ8Industrial Control Equipment-Tenth Edition; Update No. 1‡™GаˆšCT7Щ@Standard Marking System for Valves, Fittings, Flanges and UnionsЄ8ЩQuality Standard for Steel Castings for Valves, Flanges, Fittings and Other Piping Components - Visual Method for Evaluation of Surface IrregularitiesT8Щ–іі€5і і|Бд=PT9Щ+Valve Inspection and Testing-Eighth Edition`ђF0ВКЉ@` T:Щ+Valves - Flanged, Threaded, and Welding End`ђF0ВКЉ@` €;ЩAcoustics - Attenuation of Sound During Propagation Outdoors - Part 2: General Method of Calculation-First EditionT;Щrііˆ5і і|Бд=Pl<ЩGeneral requirements for the competence of testing and calibration laboratories-Second editionT<Щ^і іŒ5і і|Б д=PT=Щ<A DTV Profile for Uncompressed High Speed Digital Interfaces` T>Щ<A DTV Profile for Uncompressed High Speed Digital Interfaces` ?ЩInformation technology - Security techniques - Information security management systems - Requirements-First EditionT?Щsіі˜5і і|Бд=P]@ЩMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: April 2000T@ЩOііœ5і і|Б д=PlAЩGeneral requirements for the competence of testing and calibration laboratories-Second editionTAЩ^ііЂ5і і|Б д=P|BЩGuidelines for the selection of quality management system consultants and use of their services-ISO 10019:2005TBЩnііІ5і і|Бд=P|CЩGuidelines for the selection of quality management system consultants and use of their services-ISO 10019:2005TCЩnііЈ5і і|Б д=P|DЩGuidelines for the selection of quality management system consultants and use of their services-ISO 10019:2005TDЩnііЊ5і і|Б д=P|EЩGuidelines for the selection of quality management system consultants and use of their services-ISO 10019:2005TEЩnііЌ5і і|Б д=PˆFЩStandard Specification for Steel Castings, Surface Acceptance Standards, Magnetic Particle and Liquid Penetrant InspectionTFЩzііА5і і|Б д=PˆGЩStandard Specification for Steel Castings, Surface Acceptance Standards, Magnetic Particle and Liquid Penetrant InspectionTGЩzііД5і і|Б д=P HЩCable Connections for Gas-Insulated Metal-Enclosed Switchgear for Rated Voltages of 72,5 kV and Above - Fluid-Filled and Extruded Insulation Cables - Fluid-Filled and Dry Type Cable-Terminations-Second Edition; Corrigendum: 02-2000; Corrigendum: 12-2000THЩ§і іИ5і і|Бд=PŸIЩRadioactive Protection - Sealed Radioactive Sources - General Requirements and Classification-Second Edition; Cancels and Replaces ISO 1677: 1977TIЩ‘і"іМ5і і|Бд=P‹JЩ(DRAFT) Safety of machinery - Emergency stop - Principles for design (ISO/DIS 13850:2005); German version prEN ISO 13850:2005TJЩ}і$іР5і і|Б д=P|KЩGuidelines for the selection of quality management system consultants and use of their services-ISO 10019:2005TKЩnі&іЦ5і і|Бд=PЩLЩRecommended Practice for Classification of Locations for Electrical Installations at Petroleum Facilities Classified as Class I, Division 1 and Division 2-First Edition; Errata 10/17/1998TLЩЛі(іЫ5і і|Б д=PqMЩQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TMЩcі*іи5і і|Б д=P„NЩMЩTHODE DДESSAI NORMALISЩE POUR LA DЩTERMINATION DE LДINCOMBUSTIBILITЩ DES MATЩRIAUX DE CONSTRUCTION-Troisieme EditionTNЩvі,ін5і і|Бд=P„OЩMЩTHODE DДESSAI NORMALISЩE POUR LA DЩTERMINATION DE LДINCOMBUSTIBILITЩ DES MATЩRIAUX DE CONSTRUCTIOM-Troisieme EditionTOЩvі.іп5і і|Бд=P„PЩMЩTHODE DДESSAI NORMALISЩE POUR LA DЩTERMINATION DE LДINCOMBUSTIBILITЩ DES MATЩRIAUX DE CONSTRUCTION-Troisieme EditionTPЩvі0іс5і і|Бд=PQQЩCastings, Classification and Inspection of-Superseding AMS-STD-2175TQЩCі2іф5і і|Бд=PaRЩEnvironmental management systems Requirements with guidance for use-Second EditionTRЩSі4іш5і і|Бд=P~SЩInformation technology Security techniques Code of practice for information security management-Second EditionTSЩpі6іь5і і|Бд=P~TЩInformation technology Security techniques Code of practice for information security management-Second EditionTTЩpі8і№5і і|Б д=P—UЩTest sieves Technical requirements and testing Part 1: Test sieves of metal wire cloth-Fourth Edition; Technical Corrigendum 1:9/1/2004TUЩ‰і:іє5і і|Бд=P—VЩTest sieves Technical requirements and testing Part 1: Test sieves of metal wire cloth-Fourth Edition; Technical Corrigendum 1:9/1/2004TVЩ‰і<іі5і і|Бд=P—WЩTest sieves Technical requirements and testing Part 1: Test sieves of metal wire cloth-Fourth Edition; Technical Corrigendum 1:9/1/2004TWЩ‰і>іј5і і|Бд=PaXЩEnvironmental management systems Requirements with guidance for use-Second EditionTXЩSі@іќ5і і|Б д=PaYЩEnvironmental management systems Requirements with guidance foq use-Second EditionTYЩSіBіў5і і|Б д=PaZЩEnvironmental management systems Requirements with guidance for use-Second EditionTZЩSіDі6і і|Б д=Pa[ЩEnvironmental management systems Requirements with guidance for use-Second EditionT[ЩSіFі6і і|Б д=P\Щa\ЩEnvironmental manaeement systems Requirements with guidance for use-Second Editionstems Requirements with guidance for use-Second EditionTZЩSіDі6і і|Б д=P[Щa[ЩEnvironmental management systems Requirements with guidance for use-Second EditionCАs"D`s"Ds"D "D@"DecQuщbecCanadaCanadaCaп}ШgВ^§ЉО'г<шj˜Dу>ъfŽ:Жbёд€А%б2о г  ї Ѓ  Ч K ї { ' ЋWл‡Чj•Aэ™-йYБ]ЙeН`џF˜йO3їSˆaSу,T\ЩSіH6ї ї|Бд=P]ЩGeneral Specification for Electrical/Electronic Component Analytical/Development/Validation (A/D/V) Procedures for Conformance to Vehicle Environmental, Reliability, and Performance Requirements-Engl; Revision E; Replaces GM9123P and GMI 12558T]Щѓїї 6ї ї|Б д=PP^ЩPerformance Measurements of Scintillation Cameras-Errata: 02/02/04T^ЩBїї 6ї ї|Б д=PŠ_ЩInformation technology equipment Safety Part 1: General requirements-CORR 14424: July 10, 2003; AMD 15459: January 5, 2005T_Щ|її6ї ї|Б д=Pr`ЩAircraft - Four-Wheel-Drive Tow Tractors - Performance Requirements Factors for Design First EditionU`Щdїї6ї ї|Бд=PЎaЩAircraft Ground Equipment - Basic Requirements - Part 1: General Design Requirements-First Edition; Together with ISO 6966-2, Cancels and Replaces ISO 6966:1993TaЩ ї ї6ї ї|Бд=PІbЩAircraft Ground Equipment - Basic Requirements - Part 2: Safety Requirements-First Edition; Together with ISO 6966-1, Cancels and Replaces ISO 6966:1993TaЩ˜ї ї6ї ї|Бд=PlcЩEarth-Moving Machinery - Safety Signs and Hazard Pictorials - General Principles First EditionTcЩ^ї ї!6ї ї|Бд=P‰dЩEarth-moving machinery - Falling-object protective structures - Laboratory tests and performance requirements-Fifth EditionTdЩ{її#6ї ї|Бд=PTeЩ7Quality Management Systems - Requirements-Third EditionКЉ@` ЖwЩProject 25 over-the-Rekeying (OTAR) Protocol Addendum 1 - Key Management Security Requirements for Type 3 Block Encryption Algorithms-Addendum No. 1 to TIA/EIA-102.AACATwЩЈїїF6ї ї|Бд=PЛxЩLes principes essentiels de la norme ISO 15189:2003 Un guide pratique pour la mise en uvre de la norme ISO 15189:2003 dans les laboratoires d analyses de biologie mщdiaaleTxЩ­їїJ6ї ї|Б д=P•yЩThe ISO 15189:2003 essentials A practical handbook for implementing the ISO 15189:2003 Standard for medical laboratories-First EditionTyЩ‡їїL6ї ї|Б д=PhzЩSpecification for Fusion Welding for Aerospace Applications-Incorporating Errata - 07/2001TzЩZїїP6ї ї|Б д=P{{ЩGuidelines for the selection of quality management system consultants and use of their services-First EditionT{ЩmїїW6ї ї|Бд=Pm|ЩGuidelines for the selection of quality management system consultants and use of their servicesT|Щ_їїY6ї ї|Б д=Pm}ЩGuidelines for the selection of quality management system consultants and use of their servicesT}Щ_її[6ї ї|Б д=Pm~ЩGuidelines for the selection of quality management system consultants and use of their servicesT~Щ_ї ї]6ї ї|Б д=PmЩGuidelines for the selection of quality management system consultants and use of their servicesTЩ_ї"ї_6ї ї|Б д=P|€ЩGuidelines for the selection of quality management system consultants and use of their services-ISO 10019:2005T€Щnї$їb6ї ї|Бд=P•ЩConcrete Materials and Methods of Concrete Construction/ Methods of Test and Standard Practices for Concrete-Tenth Edition; Update No 1TЩ‡ї&їn6ї ї|Б д=P2‚ЩISO STANDARDS COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISM 14001, 14004, 14010, 14011, 14012, DIS 14015, 14020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041, 14042, 14043, TR 14049, 14050, AND TR 14061; SEE ALSO ISO 14000 SERIES AND CDT‚Щ$ї(їv6ї ї|Б д=P2ƒЩISO STANDARDS COMPENDIUM - ISO 14000 - ENVIRONMENTAL MANAGEMENT-Second Edition; INCLUDES ISO GUIDE 64, ISO 14001, 14004, 14010, 14011, 14012, DIS 14015, 14020, 14021, 14024, TR 14025, 14031, TR 14032, 14040, 14041, 14042, 14043- TR 14049, 14050, AND TR 14061; SEE ALSO ISO 14000 SERIES AND CDTƒЩ$ї*їy6ї ї|Б д=P–„ЩInformation Technology - Automatic Identification and Data Capture Techniques - Bar Code Symbology Specifications - PDF417-First EditionT„Щˆї,ї6ї ї|Б д=PT…Щ8National Consensus Standard for Configuration ManagementКЉ@p T†Щ8National Consensus Standaqd for Configuration ManagementКЉ@  T‡Щ8National Consensus Standard for Configuration ManagementКЉ@  TˆЩ8National Consensus Standard for Configuration ManagementКЉ@  T‰Щ.CORROSION PREVENTIVE, COATING - NORMAL STORAGE`ВЗG0В КЉ@` TŠЩ.CORROSION PREVENTIVE, COATING - NORMAL STORAGEЭG0РЭGdРЭGT‹Щ>Requirements for Soldered Electrical and Electronic AssembliesTŒЩ>Requirements for Soldered Electriaal and Electronic AssembliesTЩ>Requirements for Soldered Electrical and Electronic AssembliesTŽЩ>Requirements for Soldered Electrical and Electronic AssembliesTЩ>Requirements for Soldered Electrical and Electronic Assemblies•ЩConcrete Materials and Methods of Concrete Construction/ Methods of Test and Standard Practices for Concrete-Tenth Edition; Update No 1TЩ‡ї9їЈ6ї ї|Бе=P•‘ЩConcrete Materials and Methods of Concrete Construction/ Methods of Test and Standard Practices for Concrete-Tenth Edition; Update No 1T‘Щ‡ї;їЌ6ї ї|Бд=Pe’ЩISO 9000: ISO STANDARDS COLLECTION ON CD-ROM - QUALITY MANAGEMENT-SEE ALSO ISO 14000 CDT’ЩWї=їВ6ї ї|БЕд=Pe“ЩISO 9000: ISO STANDARDS COLLECTION ON CD-ROM - QUALITY MANAGEMENT-SEE ALSO IQO 14000 CDT“ЩWї?їД6ї ї|БЕд=Pe”ЩISO 9000: ISO STANDARDS COLLECTION ON CD-ROM - QUALITY MANAGEMENT-SEE ALSO ISO 14000 CDT”ЩWїAїЖ6ї ї|БЕд=PdІЩPhotography - Electronic Still-Picture Cameras - Resolution Measurements-First EditionTІЩVїCїг6ї ї|Бд=PЇЩVЇЩPhotography Electromic still picture imaging Vocabulary-Second Edition14000 CDT”ЩWїAїЖ6ї ї|БЕд=PІЩdІЩPhotography - Electronic Still-Picture Cameras - Resolution Measurements-First EditionTІЩVїCїг6ї ї|Бд=Pн{У^ ЅQь˜ЏЦrЪv"Юz&в~*”@Кˆ4ŸKЯ{КMљ Œ 8 Ы w ќ Ј @ ь W  H є>ъ– ЙMљSџQ§‹7­Y ЕД`џH˜й~јSN™С4TЇЩHїEе6ј ј|Бд=P]ЈЩPhotography Electronic still-picture imaging Noise measurements-First EditionTЈЩOјји6ј ј|Бд=PƒЉЩPhotography - Projection of Still Pictures - Measuring Methods for the Evaluation of Imaging Properties-First EditionTЉЩuјјк6ј ј|Бд=PАЊЩPhotography Digital still cameras Determination of exposure index, ISO speed ratings, standard output sensitivity, and recommended exposure index-Second EditionTЊЩЂјјм6ј ј|БЕд=PЋЩPhotography - Electronic Still-Picture Cameras - Methods for Measuring Opto-Electronic Conversion Functions (OECFs)-First EditionTЋЩјјн6ј ј|Бд=PyЌЩGENERAL REQUIREMENTS FOR THE COMPETENCE OF TESTING AND CALIBRATION LABORATORIES-Same as ISO/IEC 17025: 2005TЌЩkј јт6ј ј|БЕд=Pa­ЩEnvironmental management systems Requirements with guidance for use-Second EditionT­ЩSј јъ6ј ј|Б д=PaЎЩEnvironmental management systems Requirements with guidance for use-Second EditionTЎЩSј јь6ј ј|Б д=PaЏЩEnvironmental management systems Requirements with guidance for use-Second EditionTЏЩSјјю6ј ј|Б д=PlАЩGeneral requirements for the competence of testing and calibration laboratories-Second editionTАЩ^јј№6ј ј|Б д=PaБЩEnvironmental management systems Qequirements with guidance for use-Second EditionTБЩSјјђ6ј ј|БЕд=PYВЩCement-bonded particleboards - Specification - Part 1: General requirementsTВЩKјјј6ј ј|Б д=PaГЩEnvironmental management systems Requirements with guidance for use-Second EditionTГЩSјјќ6ј ј|Б д=PYДЩCement-bonded particleboards - Specification - Part 1: General requirementsTДЩKјјў6ј ј|БЕд=PYЕЩCement-bonded particleboards - Specification - Part 1: General requirementsTЕЩKјј7ј ј|БЕд=PYЖЩCement-bonded particleboards - Specification - Part 1: General requirementsTЖЩKјј7ј ј|БЕд=PTЗЩParticleboards - Specifications`’LF0ВЕКЉ@` aИЩEnvironmental management systems Requirements with guidance for use-Second EditionTИЩSј ј7ј ј|Бд=PaЙЩEnvironmental management systems Requirements with guidance for use-Second EditionTЙЩSј"ј 7ј ј|Бд=PTКЩSafety standard for lift trucks`RпG0В КЉ@` TЛЩParticleboards - Specifications`В G0ВКЉ@` TМЩParticleboards - Specifications0ВЕЭЋL0€4FpдC(ИЖG4ВЕКЉ@TНЩParticleboards - Specifications0ВЕЭЋL0€4FpдC(ИЖG4ВЕКЉ@ƒОЩPackaging - Complete, Filled Transport Packages - Vertical Impact Test by Dropping-Second Edition; CEN EN 22248: 1992TОЩuј(ј7ј ј|Б д=PшПЩConformity assessment General qequirements for accreditation bodies accrediting conformity assessment bodies-First Edition; Corrected Version 2/15/2005; Replaces ISO Guide 58:1993, ISO Guide 61:1996, ISO TR 17010:1998TПЩкј*ј 7ј ј|БЕд=PPРЩCommercial Building Telecommunications Cabling Standard Part 1: General Requirements, Part 2: Balanced Twisted-Pair Cabling Components, and Part 3: Optical Fiber Cabling Components Standard-Includes Addendums: B.1-1, B.1-2, B.1-3, B.1-4, B.1-5, B.2-1, B.2-2, B.2-3, B.2-4, B.2-4, B.2-5, B.2-6, B.2-11, and B.3-1 12/02/2005TРЩBј,ј$7ј ј|Бд=PPСЩCommercial Building Telecommunications Cabling Standard Part 1: General Requirements, Part 2: Balanced Twisted-Pair Cabling Components, and Part 3: Optical Fiber Cabling Components Standard-Includes Addendums: B.1-1, B.1-2, B.1-3, B.1-4, B.1-5, B.2-1, B.2-2, B.2-3, B.2-4, B.2-4, B.2-5, B.2-6, B.2-11, and B.3-1 12/02/2105TСЩBј.ј&7ј ј|Бд=PшТЩConformity assessment General requirements for accreditation bodies accrediting conformity assessment bodies-First Edition; Corrected Version 2/15/2005; Replaces ISO Guide 58:1993, ISO Guide 61:1996, ISO TR 17010:1998TТЩкј0ј,7ј ј|БЕд=PaУЩEnvironmental management systems Requirements with guidance for use-Second EditionTУЩSј2ј27ј ј|Бд=PlФЩGeneral requirements for the competence of testing and calibration laboratories-Second editionTФЩ^ј4ј67ј ј|Б д=PlХЩGeneral requirements for the competence of testing and calibration laboratories-Second editionTХЩ^ј6ј87ј ј|Бд=PTЦЩ9Standard Practices for Cycle Countine in Fatigue AnalysisЉ@` wЧЩMedical Devices - Application of Risk Management to Medical Devices-First Edition; Amendment 1: 3/01/2003TЧЩiј9ј@7ј ј|Б д=PnШЩMedical devices Quality management systems Requirements for regulatory purposes-Second EditionTШЩ`ј;јB7ј ј|Б д=P]ЩЩMicrofilm and Electronic Images as Documentary Evidence-Amendment 1: Aprim 2000TЩЩOј=јF7ј ј|Б д=PTЪЩ*Decimal Inch Drawing Sheet Size and FormatиВЉD0В КЉ@ш ЂЫЩSampling Procedures for Inspection by Attributes - Part 2: Sampling Plans Indexed by Limiting Quality (LQ) for Isolated Lot Inspection-First EditionTЫЩ”ј@јO7ј ј|Б д=PTЬЩ>Recommended Practice for Electrical Installations on Shipboard‰ЭЩGeneral Requirements for the Competence of Reference Material Producers-Second Edition; TECHNICAL CORRIGENDUM 1: 11-15-2003TЭЩ{јCј\7ј ј|Б д=PfЮЩReference materials - General and statistical principles for certification-Third EditionTЮЩXјEј^7ј ј|БЕд=PЯЩdЯЩLifejackets and Personal Buoyancy Aids - Lifejackets - 150 N-AMD 10068; November 19989ECHNICAL CORRIGENDUM 1: 11-15-2003TЭЩ{јCј\7ј ј|Б д=PЮЩfЮЩReference materials - General and statistical principles for certification-Third EditionTЮЩXјEј^7ј ј|БЕд=PDшКŒ^0дІxJюР’d6к Ќ ~ P œ:д€їЃO­YЈTц’ЧsГGѓ’>VВ^Кв~ћЇSџ Ћ W і Ђ A э ™ @ ь “ ? ц ’ 1 н„0Я{ЛZЅQ№œ#Я@ь<шeД`џ?˜йdљSц‡TЯЩVјGb7љ љ|Бд=P†аЩInformation technology - Security techniques - Code of practice for information security management (ISO/IEC 17799:2005)TаЩxљљq7љ љ|Бд=PžбЩProficiency Testing by Interlaboratory Comparisions - Part 1: Development and Operation of Laboratory Proficiency Testing Schemes-Second EditionTбЩљљu7љ љ|Б д=P­вЩProficiency Testing by Interlaboratory Comparisions - Part 2: Selection and Use of Proficiency Testing Schemes by laboratory Accreditation Bodies-First EditionTвЩŸљљw7љ љ|Б д=POгЩCity and trekking bicycles - Safety requirements and test methodsTгЩAљљ}7љ љ|Бд=PTдЩ0Project Risk Management - Application Guidelines`ВH0ВКЉ@` TеЩ0Project Risk Management - Application Guidelines`rТB0В КЉ@` TжЩ0Project Risk Management - Application Guidelines`rТB0В КЉ@` гзЩElectromagnetic Compatibility (EMC) - Part 4-2: Testing and Measurement Techniques - Electrostatic Discharge Immunity Test-Edition 1.2; Edition 1:1995 Consolidated with Amendments 1:1998 and 2:2000TзЩХљ љŒ7љ љ|Бд=PгиЩElectromagnetic Compatibility (EMC) - Part 4-2: Testing and Measurement Techniques - Electrostatic Discharge Immunity Test-Edition 1.2; Edition 1:1995 Consolidated with Amendments 1:1998 and 2:2000TиЩХљљŽ7љ љ|Бд=P­йЩElectromagnetic compatibility (EMC) – Part 4-3: Testing and measurement techniques – Radiated, radio-frequency, electromagnetic fiemd immunity test-Edition 3.0TйЩŸљљ7љ љ|БЕд=PŸкЩElectromagnetic compatibility (EMC) Part 4-4: Testing and measurement techniques Electrical fast transient/burst immunity test-Second EditionTкЩ‘љљ’7љ љ|БЕд=P…лЩElectromagnetic compatibility (EMC) – Part 4-5: Testing and measurement techniques – Surge immunity test-Second EditionTлЩuљљ”7љ љ|БЕд=PЅмЩElectrical equipment for measurement, control and laboratory use EMC requirements Part 1: General requirements-Edition 1.0: Replaces IEC 61326:2002TмЩ—љљ–7љ љ|Б д=P?нЩElectrical equipment for measurement, control and laboratory use EMC requirements Part 2-1: Particular requirements Test configurations, operational conditions and performance criteria for sensitive test and measurement equipment for EMC unprotected applications-Edition 1.0; Replaces IEC 61326:2002TнЩ1љљ˜7љ љ|Б д=PЪоЩElectromagnetic compatibility (EMC) – Part 4-6: Testing and measurement techniques – Immunity to conducted disturbances, induced by radio-frequency fields-Edition 2.2; Consolidated ReprintTоЩМљљš7љ љ|Б д=PКпЩElectromagneuic compatibility (EMC) - Part 4-11: Testing and measurement techniques - Voltage dips, short interruptions and voltage variations immunity tests-Second EditionTпЩЌљљœ7љ љ|Б д=PЅрЩElectrical equipment for measurement, control and laboratory use EMC requirements Part 1: General requirements-Edition 1.0: Replaces IEC 61326:2002TрЩ—љљž7љ љ|Б д=P?сЩElectqical equipment for measurement, control and laboratory use EMC requirements Part 2-1: Particular requirements Test configurations, operational conditions and performance criteria for sensitive test and measurement equipment for EMC unprotected applications-Edition 1.0; Replaces IEC 61326:2002TсЩ1љ љ 7љ љ|Б д=PУтЩSafety Requirements for Electrical Equipment for Measurement, Control, and Laboratory Use - Part 1: General Requirements-Second Edition; Corrigendum 1:05/2002; Corrigendum 2:04/2003TтЩЕљ"љЂ7љ љ|Бд=PЂуЩElectromagnetic compatibility (EMC) Part 2-13: Environment High-power electromagnetic (HPEM) environments Radiated and conducted-First EditionTуЩ”љ$љЄ7љ љ|Бд=P~фЩInformation technology equipment – Safety – Part 1: General requirements-Second Edition; Replaces IEC!60950:1999TфЩpљ&љІ7љ љ|Бд=PTхЩ%Carbon Steel Forgings for General Use`RЧC0ВЕКЉ@` >цЩElectromagnetic Compatibility (EMC) - Part 3-3: Limits - Limitation of voltage changes, voltage fluctuations and flicker in public low-voltage supply systems, for equipment with rated current less than or equal to 16 A per phase and not subject to conditional connection-Edition 1.2; Consolidated ReprintTцЩ0љ)љЌ7љ љ|Б д=PЂчЩElectromagnetic compatibility (EMC) . Part 3-2: Limits . Limits for harmonic current emissions (equipment input current .16 A per phase)-Edition 3.0TчЩ”љ+љЎ7љ љ|Б д=PaшЩEnvironmental management systems Requirements with guidance for use-Second EditionTшЩSљ-љВ7љ љ|Б д=PщЩIneormation technology - Security techniques - Information security management systems - Requirements-First EditionTщЩsљ/љЗ7љ љ|Б д=P~ъЩInformation technology Security techniques Code of practice for information security management-Second EditionTъЩpљ1љЙ7љ љ|Б д=PqыЩQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9103:1994TыЩcљ3љН7љ љ|Б д=P_ьЩInformation technology - Service management - Part 1: Specification-First EditionTьЩQљ5љП7љ љ|Б д=PbэЩInformation technology - Service management - Part 2: Code of practice-First EditionTэЩTљ7љС7љ љ|Б д=PюЩInformation technology - Security techniques - Information security management systems - Requirements-First EditionTюЩsљ9љХ7љ љ|Б д=P~яЩInformation technology Security techniques Code of practice for information security management-Second EditionTяЩpљ;љЧ7љ љ|Б д=P_№ЩInformation technology - Service management - Part 1: Specification-First EditionT№ЩQљ=љЩ7љ љ|Б д=P~яЩInformation technology Security techniques Code of practice for information security management-Second EditionTяЩpљ;љЧ7љ љ|Б д=P№Щ_№ЩInformation technology - Service management - Part 1: Specification-First Editionш Л Ž a 4  к ­ € S & љ Ь Ÿ r Ъk™EФpК[–BФpя›:цD№В^ Œ8–B+ь˜ѓŸх ‘ Ч s 4 р ; ч b  onGѓ Ьx$а-€,Ž:Д`џ>˜йR2њTШu„ёЩQuality management. Coherence of the overall quality control, quality assurance and iso 9000 certification approaches.TёЩvњњЮ7њ њ|Б д=P„ђЩQuality management. Coherence of the overall quality control, quality assurance and iso 9000 certification approaches.TђЩvњњб7њ њ|Б д=P„ѓЩQuality management. Coherence of the overall quality control, quality assurance and iso 9000 certification approaches.TѓЩvњњг7њ њ|Б д=P”ЪMeasurement of Conductive Liquid Flow in Closed Conduits - Method Using Electromagnetic Flowmeters First Edition-CEN EN ISO 6817: 1995TЪ†њњы7њ њ|БЕд=PБЪMeasurement of Fluid Flow in Closed Conduits - Methods of Evaluating the Performance of Electromagnetic Flow- Meters for Liquids First Edition (CEN EN 29104: 1993)TЪЃњњэ7њ њ|Бд=PŽЪMeasurement of fluid flow - Procedures for the evaluation of uncertainties-Second edition; Cancels and replaces ISO/TR 5168:1998TЪ€њ њя7њ њ|Бд=P›ЪAssessment of Uncertainty in the Calibration and Use of Flmw Measurement Devices - Part 2: Non-Linear Calibration Relationships First EditionTЪњ њё7њ њ|Бд=P’ ЪAssesment of Uncertainty in Calibration and Use of Flow Measurement Devices - Part 1: Linear Calibration Relationships-First EditionT Ъ„њњѓ7њ њ|Бд=Pc ЪMeasurement of Fluid Flow - Methods of Specifying Flowmeter Performance-First EditionT ЪUњњѕ7њ њ|Бд=Pq ЪQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994T Ъcњњљ7њ њ|Бд=PT Ъ>Screw, Self-Locking-Flat Fillister Head, Full Thread (Rev. 10)В ЪScrew, Cap, Socket Head Undrilled and Drilled, Plain and Self-Locking Alloy Steel, Corrosion- Resistant Steel and Heat-Resistant Steel, UNRC-3A and UMRC-2A (Rev. 9)T ЪЄњњ8њ њ|БЕд=PlЪGeneral requirements for the competence of testing and calibration laboratories-Second editionTЪ^њњ 8њ њ|БЕд=PбЪGreenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhancements-First EditionTЪУњњ8њ њ|Б д=P’ЪGreenhouse gases Part 3: Specification with guidance for the validation and verification of greenhouse gas assertions-First EditionTЪ„њњ8њ њ|Б д=PбЪGreenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhancements-First EditionTЪУњњ8њ њ|Бд=P›ЪSafety of machinery Basic concepts, general principles for design Part 1: Basic terminology, methodology-First Edition; Replaces TR 12100-1TЪњњ8њ њ|Бд=P‘ЪSafety of machinery Basic concepts, general principles for design Part 2: Technical principles-First Edition; Replaces TR 12100-2TЪƒњ!њ8њ њ|Бд=PЪConception et installation des systшmes d щnergie du sol-Premiere Edition; Remplace CAN/CSA-C445-M92 and C447-94; Mise a Jour no 1TЪ‚њ#њ 8њ њ|Бд=PЪConception et installation des systшmes d щnergie du sol-Premiere Edition; Remplace CAN/CSA-C445-M92 and C447-94; Mise a Jour no 1TЪ‚њ%њ$8њ њ|Бд=PЪConaeption et installation des systшmes d щnergie du sol-Premiere Edition; Remplace CAN/CSA-C445-M92 and C447-94; Mise a Jour no 1TЪ‚њ'њ)8њ њ|Б д=PУЪSafety Requirements for Electrical Equipment for Measurement, Control, and Laboratory Use - Part 1: General Requirements-Second Edition; Corrigendum 1:05/2002; Corrigendum 2:04/2003TЪЕњ)њ08њ њ|Б д=PЅЪElectrical equipment for measurement, control and laboratory use EMC requirements Part 1: General requirements-Edition 1.0: Replaces IEC 61326:2002TЪ—њ+њ28њ њ|Бд=P?ЪElectrical equipment for measurement, control and laboratory use EMC requirements Part 2-1: Particular requirements Test configurations, operational conditions and performance criteria for sensitive test and measurement equipment for EMC unprotected applications-Edition 1.0; Replaces IEC 61326:2002TЪ1њ-њ48њ њ|Б д=P­ЪElectromagnetic compatibility (EMC) – Part 4-3: Testing and measurement techniques – Radiated, radio-frequency, electromagnetic field immunity test-Edition 3.0TЪŸњ/њ68њ њ|Б д=PŸЪElectromagnetic compatibility (EMC) Part 4-4: Testing and measurement techniques Electrical fast transient/burst immuniuy test-Second EditionTЪ‘њ1њ88њ њ|Бд=P…ЪElectromagnetic compatibility (EMC) – Part 4-5: Testing and measurement techniques – Surge immunity test-Second EditionTЪwњ3њ:8њ њ|Бд=PЪЪElectromagnetic compatibility (EMC) – Part 4-6: Testing and measurement techniques – Immunity to conducted disturbances, induced by radio-frequency fields-Edition 2.2; Consolieated ReprintTЪМњ5њ<8њ њ|Бд=PКЪElectromagnetic compatibility (EMC) - Part 4-11: Testing and measurement techniques - Voltage dips, short interruptions and voltage variations immunity tests-Second EditionTЪЌњ7њ>8њ њ|Б д=PгЪElectromagnetic Compatibility (EMC) - Part 4-2: Testing and Measurement Techniques - Electrostatic Discharge Immunity Test-Edition 1.2; Edition 1:1995 Consolidated with Amendments 1:1998 and 2:2000TЪХњ9њB8њ њ|Б д=PT Ъ7Quality Management Systems - Requirements-Third EditionH0Р>H,ВЕѕ!ЪInformation Technology - Coding of Moving Pictures and Associated Audio for Digital Storage Media at up to About 1,5 Mbit/s - Part 2: Video-First Edition; Corrigendum 1: 4/15/1996; Corrigendum 2: 12/1/1999; Corrigendum 3: 11/1/2003T!Ъчњ<њU8њ њ|Бд=Plity Management Systems - Requirements-Third EditionH0Р>H,ВЕ!Ъѕ!ЪInformation Technology - Coding of Moving Pictures and Associated Audio for Digital Storage Media at up to About 1,5 Mbit/s - Part 2: Video-First Edition; Corrigendum 1: 4/15/1996; Corrigendum 2: 12/1/1999; Corrigendum 3: 11/1/2003@ощ•An` Bюiv"u!тŽщ•в~юš Ж&вAэRў - й G ѓ " Ю b  \  ДCяŒ8ІRЗcеа|ш”М8ф`џ?˜йkћUОб9"ЪInformation Technology - Coding of Moving Pictures and Associated Audio for Digital Storage Media at up to About 1,5 Mbit/s - Part 1: Systems-First Edition; CEN EN ISO/IEC 11172-1: 1995; AS/NZS 4230.1: 1994; Corrigendum 1: 1996; Corrigendum 2: 1999T"ЪјћћW8ћ ћ|Бд=P#ЪInformation Technology - Coding of Moving Pictures and Associated Audio for Digital Storage Media at up to About 1,5 Mbit/s - Part 1: Systems-First Edition; CEN EN ISO/IEC 11172-1: 1995; AS/NZS 4230.1: 1994; Corrigendum 1: 1996; Corrigendum 2: 1999T#ЪјћћZ8ћ ћ|Бд=Pѕ$ЪInformation Technology - Coding of Moving Pictures and Associated Audio for Digital Storage Media at up to About 1,5 Mbit/s - Part 2: Video-First Edition; Corrigendum 1: 4/15/1996; Corrigendum 2: 12/1/1999; Corrigendum 3:!11/1/2003T$Ъчћћ\8ћ ћ|Бд=PŽ%ЪOccupational health and safety management systems Guidelines for the implementation of OHSAS 18001-AMD 14224: December 13, 2002T%Ъ€ћћ`8ћ ћ|БЕд=Ps&ЪPaper, Board and Pulps - Measurement of Diffuse Blue Reflectance Factor (ISO Brightness)-Third EditonT&Ъeћћd8ћ ћ|БЕд=PT'Ъ"OSCILLATOR, HIGH VOLTAGE, 10549785`В~G0ВЕКЉ@` X(ЪStandard Test Methods for Notched Bar Impact Testing of Metallic MaterialsT(ЪJћ ћl8ћ ћ|Б д=PT)Ъ@International Vocabulary of Basic and General Terms in Metrologyб*ЪGreenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reduations or removal enhancements-First EditionT*ЪУћћu8ћ ћ|БЕд=P’+ЪGreenhouse gases Part 3: Specification with guidance for the validation and verification of greenhouse gas assertions-First EditionT+Ъ„ћћw8ћ ћ|БЕд=P ,ЪGaz р effet de serre Partie 2: Spщcifications et lignes directrices, au niveau des projets, pour la quantification, la surveillance et la dщclaration des rщductions d'щmissions ou d'accroissements de suppressions des gaz р effet de serre-Premiшre щditionT,Ъџћћ{8ћ ћ|Б д=P -ЪGaz р effet de serre Partie 2: Spщcifications et lignes directrices, au niveau des projets, pour la quantification, la surveillance et la dщclaration des rщductions d'щmissions ou d'accroissements de suppressions des gaz р effet de serre-Premiшre щditionT-Ъџћћ}8ћ ћ|Б д=PВ.ЪStandard Test Method for Determining Rate of Air Leakage Through Exterior Windows, Curtain Walls, and Doors Under Specified Pressure Differences Across the SpecimenT.ЪЄћћ8ћ ћ|Б д=P›/ЪStandard Test Method for Water Penetration of Exterior Windows, Skylights, Doors, and Curtain Walls by Uniform Static Air Pressure DifferenceT/Ъћћƒ8ћ ћ|БЕд=PŸ0ЪStandard Test Method for Structural Performance of Exterior Windows, Doors, Skylights and Curtain Walls by Uniform Static Air Pressure DifferenceT0Ъ‘ћћ…8ћ ћ|БЕд=PЧ1ЪStandard Test Method for Field Determination of Water Penetration of Installed Exterior Windows, Skylights, Doors, and Curtain Walls, by Uniform or Cyclic Static Air Pressure DifferenceT1ЪЙћћ‡8ћ ћ|БЕд=PT2Ъ"Methods of Test for Exterior WallslКЕXЬЋH0ѓзH0ВЕКЉ@ˆ Е3ЪMedical devices Symbols to be used with medical device labels, labelling and information to be supplied-First Edition: Amendment 1: 8/01/2002; Amendment 2: 02/15/2004T3ЪЇћћ‘8ћ ћ|БЕд=Pб4ЪGreenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhancements-First EditionT4ЪУћ!ћ™8ћ ћ|БЕд=P’5ЪGreenhouse gases Part 3: Specification with guidance for the validation and verification of greenhouse gas assertions-First EditionT5Ъ„ћ#ћ›8ћ ћ|Бд=P’6ЪGreenhouse gases Part 3: Specification with guidance for the validation and verification of greenhouse gas assertions-First EditionT6Ъ„ћ%ћ8ћ ћ|БЕд=Pб7ЪGreenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhancements-First EditionT7ЪУћ'ћЂ8ћ ћ|Бд=PpIЪCode for Power Press Operation: Health, Safety, and Guarding Requirements-Update No 1; Update No 2TIЪbћ)ћТ8ћ ћ|Б д=PTJЪ1Dimensional Tolerances for Aluminum Mill ProductsC0В КЉ@` TKЪ7Quality Management Systems - Requirements-Third EditionI(В @qLЪQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TLЪcћ-ћЭ8ћ ћ|Бд=PnMЪMedical devices Quality management!systems Requirements for regulatory purposes-Second EditionTMЪ`ћ/ћЯ8ћ ћ|Бд=PTNЪ/Rubber and Latices - Nomenclature-Third Edition`rœH0В КЉ@` ЂOЪQuality Management Systems - Requirements-Third Edition; ISO 9001: 2000; Supersedes ISO 9001-94-CAN/CSA, ISO 9002-94-CAN/CSA and ISO 9003-94-CAN/CSATOЪ”ћ2ћл8ћ ћ|Б д=PЂPЪQuality Management Systems - Requirements-Third Edition; ISO 9001: 2000; Supersedes ISO 9001-94-CAN/CSA, ISO 9002-94-CAN/CSA and ISO 9003-94-CAN/CSATPЪ”ћ4ћн8ћ ћ|БЕд=PqQЪQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TQЪcћ6ћс8ћ ћ|Бд=PTRЪ1Dimensional Tolerances for Aluminum Mill ProductsиI0ВЕКЉ@(lSЪGeneral qequirements for the competence of testing and calibration laboratories-Second editionTSЪ^ћ9ћы8ћ ћ|Б д=PlTЪGeneral requirements for the competence of testing and calibration laboratories-Second editionTTЪ^ћ;ћэ8ћ ћ|Б д=PZUЪGuideline on Durability in Buildings-General Instruction No 1; First EditionTUЪLћ=ћё8љ ћ|Бд=PTЪGeneral requirements for the competence of testing and calibration laboratories-Second editionTTЪ^ћ;ћэ8ћ ћ|Б д=PUЪZUЪGuideline on Durability in Buildings-General Instruction No 1; First Edition@№?№?HZ™l3№?УiЉUщ•Aа|к†ф<Юz Еa Ix$’>ЌX‡3~*жЛШ - й ' г Ц r e  +ZВZВ?ы] РКf`џA˜й§ќVЊ @TVЪ9Standard Test Methods for Measuring Adhesion by Tape TestЉ@8 ‘WЪBiological Evaluation of Medical Devices - Part 7: Ethylene Oxide Sterilization Residuals First Edition; (CEN EN ISO 10993-7: 1995)TWЪƒќќћ8ќ ќ|Бд=PPXЪNon-active surgical implants - General requirements-Second EditionTXЪBќќ§8ќ ќ|Бд=P…YЪNon active surgical implants - Particular requirements for cardiac and vascular implants - Part 3: Endovascular devicesTYЪwќќџ8ќ ќ|Б д=PyZЪStandard Specification for Aluminum and Aluminum-Alloy Drawn Tube and Pipe for General Purpose ApplicationsTZЪkќќ 9ќ ќ|Б д=Py[ЪStandard Specification for Aluminum and Aluminum-Alloy Drawn Tube and Pipe for General Purpose ApplicationsT[Ъkќ ќ 9ќ ќ|Б д=Py\ЪStandard Specification for Aluminum and Aluminum-Alloy Drawn Tube and Pipe for General Purpose ApplicationsT\Ъkќ ќ 9ќ ќ|Б д=Py]ЪStandard Specification for Aluminum and Aluminum-Alloy Drawn Tube and Pipe for General Purpose ApplicationsT]Ъkќ ќ9ќ ќ|Б д=Py^ЪStandard Specification for Aluminum and Aluminum-Alloy Drawn Tube and Pipe for General Purpose ApplicationsT^Ъkќќ9ќ ќ|Б д=Pl_ЪGeneral requirements for the competence of testing and calibration laboratories-Second editionT_Ъ^ќќ9ќ ќ|Бд=Pь`ЪFinancial Transaction Card"Originated Messages - Interchange Message Specifications Second Edition; (CEN EN ISO 8583: 1995)-Second Edition; CEN EN ISO 8583 :1995; Technical Corrigendum 1: 12/15/1999; Replaced by ISO 8583-1T`Ъоќќ9ќ ќ|БЕд=PбaЪGreenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhancements-First EditionTaЪУќќ9ќ ќ|Бд=P’bЪGreenhouse gases Part 3: Specification with guidance for the validation and verification of greenhouse gas assertions-First EditionTbЪ„ќќ9ќ ќ|Бд=PбcЪGreenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhancements-First EditionTcЪУќќ#9ќ ќ|Б д=PьdЪFinancial Transaction Card Originated Messages - Interchange Message Specifications Second Edition; (CEN EN ISO 8583: 1995)-Second Edition; CEN EN ISO 8583 :1995; Technical Corrigendum 1: 12/15/1999; Replaced by ISO 8583-1TdЪоќќ(9ќ ќ|Б д=PleЪGeneral requirements for the competence of testing and calibration laboratories-Second editionTeЪ^ќќ49ќ ќ|Б д=PlfЪGeneral requirements for the competence of testing and calibration laboratories-Second editionTfЪ^ќќ69ќ ќ|Б д=PlgЪGeneral requirements for the competence of testing and calibration laboratories-Second editionTgЪ^ќ!ќ89ќ ќ|БЕд=PlhЪGeneral requirements for the competence of"testing and calibration laboratories-Second editionThЪ^ќ#ќ:9ќ ќ|БЕд=PliЪGeneral requirements for the competence of testing and calibration laboratories-Second editionTiЪ^ќ%ќ>9ќ ќ|Б д=PЂjЪQuality Management Systems - Requirements-Third Edition; ISO 9001: 2000; Supersedes ISO 9001-94-CAN/CSA, ISO 9002-94-CAN/CSA and ISO 9003-94-CAN/CSATjЪ”ќ'ќB9ќ ќ|Б д=PqkЪQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TkЪcќ)ќD9ќ ќ|Б д=PqlЪQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TlЪcќ+ќF9ќ ќ|Б д=PqmЪQuality Management Systems - Requirements-Vhird Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TmЪcќ-ќH9ќ ќ|Б д=PqnЪQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TnЪcќ/ќP9ќ ќ|БЕд=PбoЪGreenhouse gases Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or"removal enhancements-First EditionToЪУќ1ќT9ќ ќ|БЕд=PьpЪFinancial Transaction Card Originated Messages - Interchange Message Specifications Second Edition; (CEN EN ISO 8583: 1995)-Second Edition; CEN EN ISO 8583 :1995; Technical Corrigendum 1: 12/15/1999; Replaced by ISO 8583-1TpЪоќ3ќa9ќ ќ|Бд=PьqЪFinancial Transaction Card Originated Messages - Interchangf Message Specifications Second Edition; (CEN EN ISO 8583: 1995)-Second Edition; CEN EN ISO 8583 :1995; Technical Corrigendum 1: 12/15/1999; Replaced by ISO 8583-1TqЪоќ5ќe9ќ ќ|Бд=PЉиOptics and Optical Instruments - Field Procedures for Testing Geodetic and Surveying Instruments - Part 1: Theory-First EditionTЉиќ7ќk9ќ ќ|Бёд=PВЊиOptics and Optical Instrumfnts - Field Procedures for Testing Geodetic and Surveying Instruments - Part 2: Levels-First Edition; Replaces ISO 8322-3 and ISO 12857-1TЊиЄќ9ќo9ќ ќ|Бёд=PуЋиOptics and Optical Instruments - Field Procedures for Testing Geodetic and Surveying Instruments - Part 4: Electro-Optical Distance Meters (EDM Instruments)-First Edition; Replaces ISO 8322-8:1992 and 12857-3:1997TЋиеќ;ќq9ќ ќ|Бёд=PЧЌиOptics and optical instruments Field procedures for testing geodetic and surveying instruments Part 7: Optical plumbing instruments-First Edition; Cancels and Replaces ISO 8322-5:1991TЌиЙќ=ќs9ќ ќ|Бёд=Pz­иConformity assessment General requirements for bodies operating certification of persons-ISO/IEC 17024: 2003T­иlќ?ќy9ќ ќ|Бёд=Pfures for testing geodetic and surveying instruments Part 7: Optical plumbing instruments-First Edition; Cancels and Replaces ISO 8322-5:1991TЌиЙќ=ќs9ќ ќ|Бёд=P­иz­иConformity assessment General requirements for bodies operating certification of persons-ISO/IEC 17024: 2003-106€?Љ/лРн‰зƒіЂЖbv"Q§Œ8ЧsЎ=щGѓ‡3ЧsГGѓ ‡ 3 G ѓ " Ю < ш  УзƒУJі})А\уТ=щ™EД`џ@˜йi%§W‚ Ь5qЎиQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TЎиc§§}9§ §|Бёд=PьРиFinancial Transaction Card Originated Messages - Interchange Message Specifications Second Edition; (CEN EN ISO 8583: 1995)-Second Edition; CEN EN ISO 8583 :1995; Technical Corrigendum 1: 12/15/1999; Replaced by ISO 8583-1TРи—9§ §|Б!д=PUСиRivet-Blind, Self-Plugging Mechanically Locked Spindle-FSC 5320; Rev. 6TСиG§§œ9§ §|Б!д=P)ТиStructural Standard for Antenna Supporting Structures and Antennas-EFFECTIVE JANUARY 1, 2006; Includes County Listing 07/20/2005 after TIA-222-G standard - Please contact Global Engineering Documents (1-800-447-3352 ext.4960) fnr a electronic version of the 07/20/2005 County ListingTТ觧Є9§ §|Бёд=P)УиStructural Standard for Antenna Supporting Structures and Antennas-EFFECTIVE JANUARY 1, 2006; Includes County Listing 07/20/2005 after TIA-222-G standard - Please contact Global Engineering Documents (1-800-447-3352 ext.4960) for a electronic version of the 07/20/2005 County ListingTУ觧І9§ §|Бёд=PTФиQuality Management Systems - Fundamentals and Vocabulary-Third EditionTФиF§ §Њ9§ §|Бёд=PTХиConformity assessment Vocabulary and general principles-First EditionTХиF§ §Ќ9§ §|Бёд=PžЦиBiological evaluation of medical devices Part 19: Physico-chemical, morphological and topographical characterization of materials-First EditionTЦи§§А9§ §|Бёд=PžЧиBiological evaluation of medical devices Part 19: Physico-chemical, morphological and topographical characterization of materials-First EditionTЧи§§В9§ §|Бёд=PTШиQuality Management Systems - Fundamentals and Vocabulary-Third EditionTШиF§§Е9§ §|Б!д=PэЩиHealth informbtics Use of mobile wireless communication and computing technology in healthcare facilities Recommendations for the management of unintentional electromagnetic interference with medical devices-First EditionTЩи裏Л9§ §|Бёд=PэЪиHealth informatics Use of mobile wireless communication and computing technology in healthcare facilities Recommendations for the management of unintentional electromagnetic interference with medical devices-First EditionTЪи裏Н9§ §|Бёд=PЫиDocument management - Electronic document file format for long-term preservation - Part 1: Use of PDF 1.4 (PDF/A-1)-First EditionTЫи§§С9§ §|Б!д=PŸЬиRoad Vehicles - Diagnostic Systems - Part 2: CARB Requirements for Interchange of Digital Information-First Edition 1994; Amendment 1: 12-01-1996TЬ葧§Ц9§ §|Бёд=PqЭиQuality Management Systems - Requirements-Third Edition; Supersedes ISO 9002:1994 and ISO 9003:1994TЭиc§§Ъ9§ §|Бёд=PѕЮиInformation Technology - Coding of Moving Pictures and Associated Audio for Digital Storage Media at up to About 1,5 Mbit/s - Part 2: Video-First Edition; Corrigendum 1: 4/15/1996; Corrigendum 2: 12/1/1999; Corrigendum 3: 11/1/2003TЮич§§Ю9§ §|Б!д=PhЯиEnvironmental Management - Environmental Performance Evaluation - Guidelines-First EditionTЯиZ§ §в9§ §|Б!д=PlаиGeneral requirements for the competence of testing and calibration laboratories-Second editionTаи^§"§ж9§ §|Бёд=PжбиGuidelines for Quality and/or Environmental"Management Systems Auditing-First Edition; Replaces ISO 10011-1:1990, ISO 10011-2:1991, ISO 10011-3:1991, ISO 14010:1996, ISO 14011:1996, and ISO 14012:1996TбиШ§$§к9§ §|Б!д=PlвиGeneral requirements for the competence of testing and calibration laboratories-Second editionTви^§&§о9§ §|Бёд=PQгиBanking Key management (retail) Part 1: Principles-Second EditinnTгиC§(§р9§ §|Бёд=PVдиMachine Tools - Safety Requirements for Integrated Manufacturing SystemsTдиH§*§ф9§ §|Б!д=PVеиMachine Tools - Safety Requirements for Integrated Manufacturing SystemsTеиH§,§ц9§ §|Бёд=PVжиMachine Tools - Safety Requirements for Integrated Manufacturing Systems TжиH§.§ш9§ §|Бёд=P]зиSafety Standard for Conveyors and Related Equipment-Revision of ASME B20.1-2000TзиO§0§ъ9§ §|Бёд=PTии9Industrial Robots and Robot Systems - Safety RequirementsP@GёйиHydraulic Fluid Power - Systems Standard for Stationary Industrial Machinery Supplement to ISO 4413; 1998 - Hydraulic Fluid Power - General Rules Relatinf to Systems-Second Edition; to be Used in Conjunction with ISO 4413: 1998Tйиу§3§ю9§ §|Бёд=PгкиSafety Color Code - environmental Facility Safety Signs - Criteria for Safety Symbols - Product Safety Sign & Labels and Accident Prevention Tags-Contains Z535.1, Z535.2, Z535.3, Z535.4, and Z535.5TкиХ§5§№9§ §|Бёд=P’лиT-Slots, Their Bolts, Nuts, and Tongues-Revisjon of ANSI B5.1-1975; Should Be Used Instead of ANSI B5.1. Which Was Cancelled in 1985Tл脧7§ђ9§ §|Бёд=PфмиPneumatic fluid power Systems standard for industrial machinery Supplement to ISO 4414:1998 Pneumatic fluid power General rules relating to systems - Must be used in conjunction with ISO 4414:1998-Third EditionTмиж§9§і9§ §|Б!д=P_ниAddenda to B15.2-1996 Safety Standard for Mechanical Power Transmission ApparatusTниQ§;§ј9§ §|Бёд=PЕоиSoil Quality - Biological Methods - Determination of Nitrogen Mineralization and Nitrification in Soils and the Influence of Chemicals on These Processes-First EditionTоиЇ§=§ќ9§ §|Бёд=PпиyпиSoil Quality - Determination of Soil Microbial Biomass - Part 2: Fumifation-Extraction Method-First Editionд=PоиЕоиSoil Quality - Biological Methods - Determination of Nitrogen Mineralization and Nitrification in Soils and the Influence of Chemicals on These Processes-First EditionTоиЇ§=§ќ9§ §|Бёд=PШ8№Ї™АИІCxџжC№фжCрєжCЌJ•AтŽЊVФpIXАSџЉUџЋUА\№œЦrВJі­<ш I ѕ f  % б ф  < шJіXА\Д‹7Кe%б`џC˜йtўW0IЛаTпиk§?ў9ў ў|Бёд=PŸриSoil Quality - Determination of Soil Water Content as a Volume Fraction on the Basis of Known Dry Bulk Density - Gravimetric Method-First EditionTри‘ўў:ў ў|Бёд=P„сиSoil quality Sampling of soil invertebrates Part 1: Hand-sorting and formalin extraction of earthworms-First EditionTсиvўў:ў ў|Бёд=P–тиSoil quality Sampling of soil invertebrates Part 2: Sampling and extraction of micro-arthropods (Collembola and Acarina)-First EditionTтиˆўў:ў ў|Бёд=PTуи1Soil quality - Determination of pH-Second EditionѓяF0ВёКЉ@p фиSoil Quality - Determination of Organic and Total Caqbon After Dry Combustion (Elementary Analysis) First EditionTфиqўў :ў ў|Бёд=PTхи>Soil Quality - Determination of Dry Bulk Density-First EditionКциSoil Quality - Determination of Particle Size Distribution in Mineral Soil Material - Method by Sieving and Sedimentation-First Edition; Technical Corrigendum 1: 03/01/2002TциЌў ў:ў ў|Бёд=PчиSoil Quality - Determination of Soil Water Content as a Volume Fraction Using Coring Sleeves - Gravimetric Method-First EditionTчиў ў:ў ў|Бёд=PЛшиSoil Quality - Sampling - Part 6: Guidance on the Collection, Handling and Storage of Soil for the Assessment of Aerobic Microbial Processess in the Laboratory First EditionTши­ўў:ў ў|Бёд=PtщиGeneral criteria for the operation of various types of bodies performing inspection-ISO/IEC 17020:1998Tщиfўў:ў ў|Б!д=PГъиGeneral Criteria for the Operation of Various Types of Bodies Performing Inspection-ISO/IEC 17020: 1998; Supersedes SANZ/SAA HB18.39: 1991 and SANZ/SAA HB18.57: 1992TъиЅўў:ў ў|Б!д=PьыиFinancial Transaction Card Originated Messages - Interchange Mesqage Specifications Second Edition; (CEN EN ISO 8583: 1995)-Second Edition; CEN EN ISO 8583 :1995; Technical Corrigendum 1: 12/15/1999; Replaced by ISO 8583-1Tыиоўў#:ў ў|Бёд=PЁьиBanking Personal Identification Number management and security Part 3: Requirements for offline PIN handling in ATM and POS systems-First EditionTьи“ўў':ў ў|Б!д=PЁэиBanking Peqsonal Identification Number management and security Part 3: Requirements for offline PIN handling in ATM and POS systems-First EditionTэи“ўў):ў ў|Бёд=PЕюиGreenhouse gases Part 1: Specification with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals-First EditionTюиЇўў-:ў ў|Б!д=PбяиGreenhouse gaqes Part 2: Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhancements-First EditionTяиУўў/:ў ў|Б!д=P’№иGreenhouse gases Part 3: Specification with guidance for the validation and verification of greenhouse gas assertions-First EditionT№и„ўў1:ў ў|Б!д=PhёиEnuironmental Management - Environmental Performance Evaluation - Guidelines-First EditionTёиZў!ў5:ў ў|Бёд=PhђиEnvironmental Management - Environmental Performance Evaluation - Guidelines-First EditionTђиZў#ў7:ў ў|Бёд=PЁѓиBanking Personal Identification Number management and security Part 3: Requirements for offline PIN handling in ATM and POS systems-Firsu EditionTѓи“ў%ў;:ў ў|Бёд=PhєиEnvironmental Management - Environmental Performance Evaluation - Guidelines-First EditionTєиZў'ў?:ў ў|Б!д=PЁѕиBanking Personal Identification Number management and security Part 3: Requirements for offline PIN handling in ATM and POS systems-First EditionTѕи“ў)ўC:ў ў|Бёд=PTіи%Solid wood panels (SWP) Requirements`вG0В!КЉ@` Tїи1Alloy and Temper Designation Systems for AluminumRsF0В!КЉ@№ kјиConformity assessment General requirements for third-party marks of conformity-First EditionTји]ў-ўT:ў ў|Б!д=PkљиConformity assessment General requirements for third-party marks of conformity-First EditionTљи]ў/ўV:ў ў|Б!д=PžњиBiological evaluation of medical devices Part 19: Physico-chemical, morphological and topographical characterization of materials-First EditionTњиў1ўY:ў ў|Бёд=PTћи9Guide To The Use Of The Wind Load Provisions Of ASCE 7-02Љ@` Tќи9Guide To The Use Of The Wind Load Provisions Of ASCE 7-02Љ@` T§и9Guide To The Use Of The Wind Lmad Provisions Of ASCE 7-02Љ@` ЁўиBanking Personal Identification Number management and security Part 3: Requirements for offline PIN handling in ATM and POS systems-First EditionTўи“ў6ўe:ў ў|Бёд=P^џи(DRAFT) Industrial platinum resistance thermometer sensors (IEC 65B/541/CD:2004)TџиPў8ўk:ў ў|Бёд=PŒйPlastics - Determination of the melt mass-flow rate (MFR) and the melt volume-flow rate (MVR) of thermoplastics-Fourth editionTй~ў:ўq:ў ў|Бёд=PgйPlastics Compression moulding of test specimens of thermoplastic materials-Third EditionTйYў<ўs:ў ў|Бёд=PпйPlastics Methods for determining the density of non-cellular plastics Part 1: Immersion method, liquid pyknometer method and titration methoe-First Edition; Together with 1183-2 and 1183-3 replaces 1183:1987Tйбў>ўu:ў ў|Бёд=P”йPlastics - Determination of tensile properties - Part 1: General principles-First Edition; Corrigendum 1-1994; Amendment 1: 09-01-2005Tй†ў@ўw:ў ў|Бёд=PйˆйPlastics - Determination of Tensile Properties - Part 2: Test Conditions for Moulding and Extrusion Pmastics-First Edition|Бёд=Pй”йPlastics - Determination of tensile properties - Part 1: General principles-First Edition; Corrigendum 1-1994; Amendment 1: 09-01-2005Tй†ў@ўw:ў ў|Бёд=P"G№?8Шр'G і'GрxI^F шў'Gчч<а4€ж"GАЧ"G8ˆр'G і'GЈM^F Œ*–BcЈTШtТ!Эy%б3пt Еa ЙФ\gЋWя› Еф  л ‡ ц ’ ё  Б ] ЊVтŽгђžф<Нi+ЇSД`џK˜й>:џXK€ TйzўBy:џ џ|Бёд=PeйPlastics - Determination of Flexural Properties-Fourth Edition; Amendment 1: 02/15/2004TйWџџ|:џ џ|Бёд=P|йPaper, Board and Pulps - Measurement of Diffuse Reflectance Factor-Third Edition; Technical Corrigendum 1-1998Tйnџџ‚:џ џ|Б!д=PnйMedical devices Quality management systems Requirements for regulatory purposes-Second EditionTй`џџ†:џ џ|Б!д=PnйMedical devices Quality management systems Requirements for regulatory purposes-Second EditionTй`џџˆ:џ џ|Бёд=P{ йCleanrooms and associated controlled environmentq Part 1: Classification of air cleanliness-Premiшre щditionT йmџ џŒ:џ џ|Б!д=P{ йCleanrooms and associated controll